SecReT6
Protein ID: 386058744
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2681
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2985302..2986402 [+]
Producthypothetical protein
NoteTssA
UniProt IDG2L1E2
KEGG IDpaf:PAM18_2681
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 3.20E-22, Aligned region: 249..259
Protein Sequence: 366 a.a.     [Download]
>gi|386058744|ref|YP_005975266.1| hypothetical protein PAM18_2681 [Pseudomonas aeruginosa M18]
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SDLLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLLRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLSEEQPPVAEADASEG
DADGEESVPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|386056071|ref|NC_017548.1|:2985302-2986402 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGC
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGATGACAG
CAGCCTGCCGACCGGCGTCTGGCAGGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGATCTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCGTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTAGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTACTGCGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCATTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGTCCGAAGAACAGCCCCCGGTCGCGGAGGCGGATGCCAGCGAAGGC
GACGCGGACGGCGAGGAAAGCGTCCCGGCGAGCGCGCCGAGCGGGCCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTACCGGCAATTGCTGCTGATCGCTGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAGTGGGGCAACAAGCCGCTGAGCGAGTTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGAGTCTGGTCGCTGCTTGGCGTACTGCCCTAA