SecReT6
Protein ID: 386059444
SecReT6 ID613
T6SS typei1
Gene symbol-
Locus tagPAM18_3381
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]3763027..3763542 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDG2LAW7
KEGG IDpaf:PAM18_3381
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-43, Aligned region: 22..157
Protein Sequence: 171 a.a.     [Download]
>gi|386059444|ref|YP_005975966.1| putative lipoprotein [Pseudomonas aeruginosa M18]
MIAMSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHP
VAFENADFFSLYERPKETLDPDLVNSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPV
TAKELTRVELKLGQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c3763542-3763027 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGATCGCCATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGC
TGGCCGGCTGTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGA
GCGGGTCAATCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCG
GTGGCGTTCGAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGG
TGAACAGCGAGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGAGGAGGGGAG
CCGCTACGTGGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTC
ACGGCGAAAGAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAATTGC
TCGGCAAGGCGGGTGACGCGCGATGA