SecReT6
Protein ID: 386059451
SecReT6 ID613
T6SS typei1
Gene symbol-
Locus tagPAM18_3388
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]3772657..3774132 [-]
Producthypothetical protein
NoteTssC
UniProt IDG2LAX4
KEGG IDpaf:PAM18_3388
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|386059451|ref|YP_005975973.1| hypothetical protein PAM18_3388 [Pseudomonas aeruginosa M18]
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAE
IDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAF
GTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c3774132-3772657 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAGCACCAGTGCCGCACAGCAAGGCCGGAACCAGAACGGCGAATACAACATTCTCGACAGCATCATCG
CCGAGACCCGCCTGAGCCCGGACGACGAGGCCTACGACATCGCCAAGCGTGGCGTCTCCGCCTTCATCGA
GGAATTGCTCAAGCCGCAGAACGACGGCGAGCCGGTGAAGAAGGCGATGGTCGACCGGATGATCGCCGAG
ATCGACGCCAAGCTCAGCACGCAGATGGACGAGATTCTCCATCATCCCGATTTCCAGGCGCTGGAGTCGG
CCTGGCGCGGCCTGCAACTGCTGGTCGACCGCACCAACTTCCGCGAGAACATCAAGATCGAGATTCTCAG
CGTTTCCAAGCAGGACCTGCTGGACGATTTCGAGGACTCGCCCGAGGTGATGCAGTCCGGCCTGTACAAG
CACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCATCGCCAACTACTACA
TGTCGCCCAGTTCGCCCGACGTCAAGCTGATGCAATACGTCTCCAGCGTGGCCTGCATGGCCCATGCGCC
ATTCGTGGCGGCCGCCGGTCCGAAGTTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGAC
CTGAAGGATCATTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCCCGCT
ACGTGGCGCTGACCGTACCGCGCTTCCTGCTGCGCACGCCCTACGATCCGGAAGAGAATCCGGTCAAGTC
GTTCGCCTACAAGGAGACCGTGGCCAACAGCCACGAGCATTACCTGTGGGGCAACACCGCCTATGCCTTC
GGCACCAAGCTGACCGACAGCTTCGCCAAGTATCGCTGGTGCCCGAACATCATCGGGCCGCAGAGCGGCG
GTGCGGTAGAGGACCTGCCGTTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCCACCGA
GGTGCTGGTGTCCGATCGCCGCGAGTACGAACTGGCCGAGGAAGGCTTCATTTCCCTGACCATGCGCAAG
GGCAGCGACAACGCCGCGTTCTTCTCCGCCAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCCG
AAGGCAAGGCCGCGGAGCTGAACTACAAGCTCGGCACCCAGTTGCCGTACATGATGATCGTCAACCGCCT
GGCCCATTACCTGAAGGTCCTGCAACGCGAACAGCTGGGGTCGTGGAAGGAGCGTACCGACCTCGAGCTG
GAGCTGAACAAGTGGATCCGCCAGTACGTCGCCGACCAGGAAAACCCCAGCGCCGAAGTGCGCGGCCGTC
GCCCGCTGCGCGCTGCACAGATCATCGTCAGTGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAACGTGCGCCCGCACTTCAAGTACATGGGGGCGGACTTCACCCTGTCGCTGGTCGGCAAGCTGGACAAA
GAGTAA