SecReT6
Protein ID: 386063053
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0080
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]94776..95456 [-]
Producthypothetical protein
NoteTagF
UniProt IDG4LC54
KEGG IDpnc:NCGM2_0080
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 6.10E-51, Aligned region: 5..142
Protein Sequence: 226 a.a.     [Download]
>gi|386063053|ref|YP_005978357.1| hypothetical protein NCGM2_0080 [Pseudomonas aeruginosa NCGM2.S1]
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGGE
AVAGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLP
APPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRF
LTGEGEVIPLFPGIPG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c95456-94776 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
TTGAACAGCGTCGGTTTCTACGGCAAGCTGGCCGGCCGCGGCGATTTCGTCAGCCGCGGCCTGCCGAACA
CCTTCGTCGAACCCTGGGACGCCTGGCTGGCCAGCGGCATGCGCGCCAGCCAGGACGAACTCGGCGCGGC
CTGGCTCGACGCCTACCTGACCAGCCCGCTGTGGCGCTTCGCCATCGCCCCCGGCCTGCTCGGCGGCGAA
GCGGTGGCCGGGGTGGTGATGCCGAGCATCGACCGGGTCGGTCGCTATTTCCCGCTGACCGTCGCCTGCC
TGCTGCCGGCGAACGCCGACCTCGGCGGGCTGGTCGGCGGCGACGACGGCTGGTTCGAGCAGGTCGAGAG
CCTGCTGCTCTCCACCCTCGAACCGGAGGCCGAGGTCGAGGCCTTCGAGCAGGCGGTGGCGCAGCTCCCG
GCCCCTCCCTGCGGACCGCGCATCGAACAATCGCTGATCAGCGGCAACCTGCTGCGCAGCGAAGCGGTGA
CCCCGGCGCAGCGCCTCGCCGCGCTGGCCCAGCATGCCTGCGACGGCGCCAGCCACTGGTGGGGACGCGG
CTCGGCACGGATCTCCGCCGGCCTGATGCGCTACCAGGGCCTGCCGCCGGCGCCGGCGTTCGGACGATTC
CTCACCGGAGAGGGCGAGGTGATCCCGCTCTTTCCCGGCATACCCGGTTAA