SecReT6
Protein ID: 386063058
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0085
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]102198..103721 [-]
Producthypothetical protein
NoteFha
UniProt IDG4LC59
KEGG IDpnc:NCGM2_0085
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-15, Aligned region: 29..97
Protein Sequence: 507 a.a.     [Download]
>gi|386063058|ref|YP_005978362.1| hypothetical protein NCGM2_0085 [Pseudomonas aeruginosa NCGM2.S1]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPLPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVVQPQPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPQPQPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLV
EGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAH
QLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
REFSRAYEEHSARLRRS
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c103721-102198 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCTGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCTGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGTCCAGCCGCAGCCAGCGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCGGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCAGCCAGCGTGGCGGCGCCGACGCCAC
CGGCAAGCGCCGCCGCGACGGCCGGCGGCGACCTGCTGCAGGCGTTCCTGCGCGGCGCCGGCATGACCCA
GTTGAAGGTCGACCCGGCCGGCGCCGAAGCGCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTG
GAAGGACTGGTGGACGTGCTGCGCGCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGA
TCCAGCCGGTGCAGAACAACCCGCTGAAGTTCGCGCCGAACGTCGACGAAGCCATGCTGCTCCTGCTGCG
CCGCGACAACCAGGCGTTCATGGCGCCGGATCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCAC
CAGCTGGCGGTGATGGCCGGCGTGCAGGCCGCCATCCGCCACCTCCTGGCGCGCTTCGAACCGGCCGCGC
TGGAAGCCCGCTTCGGCAAGCCGGCCGGGCTTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTG
GGACAGTTTCACCGAGCTGTACGCGAAGATCCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGC
CGCGAATTCAGCCGCGCCTACGAGGAACACAGCGCTCGACTACGGCGTTCCTGA