SecReT6
Protein ID: 386063059
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0086
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]104089..105123 [+]
Producthypothetical protein
NoteTssA
UniProt IDG4LC60
KEGG IDpnc:NCGM2_0086
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 156..168
Protein Sequence: 344 a.a.     [Download]
>gi|386063059|ref|YP_005978363.1| hypothetical protein NCGM2_0086 [Pseudomonas aeruginosa NCGM2.S1]
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKD
LRVANLLLQSNVALDGLDGLAEGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGV
AERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGAGESLAPGAEAVADEQVGAAPVAAVAAPAPRASGEIA
NREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|386062973|ref|NC_017549.1|:104089-105123 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCCGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACG
ACGCCGCGTTCCTCGAACTCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCT
GCCCGCCGAGCCGCCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGAC
CTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGGCTCGCCGAAGGCC
TGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGTTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGC
TGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGATGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGTC
GCCGAACGGGTCGGCTCGGCCCAGGGACTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGAGTCCTTGGCGCCGGGTGCCGAGGCGGTCGCCGA
CGAGCAGGTGGGTGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGAGCCAGCGGCGAGATCGCC
AACCGCGAAGACGTCCTGCGCCAGCTCGATCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGTC
CGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCT
CATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA