SecReT6
Protein ID: 386063061
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0088
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]105743..107239 [+]
Producthypothetical protein
NoteTssC
UniProt IDG4LC62
KEGG IDpnc:NCGM2_0088
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.90E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|386063061|ref|YP_005978365.1| hypothetical protein NCGM2_0088 [Pseudomonas aeruginosa NCGM2.S1]
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLISNDAIKSIESI
IAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQ
SPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFASCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVS
KLPSAKEA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|386062973|ref|NC_017549.1|:105743-107239 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCCGAATTGAGCACCGAGAACCTGGCCCAGGGCCAGACCACCACCGAGCAGACCAGCGAGTTCGCCA
GCCTGCTGCTGCAGGAGTTCAAGCCCAAGACCGAGCGCGCCCGCGAAGCGGTGGAGACCGCCGTGCGGAC
CCTCGCCGAGCACGCCCTGGAGCAGACCAGCCTGATCTCCAACGACGCGATCAAGTCGATCGAGTCGATC
ATCGCGGCGCTTGACGCCAAGCTCACCGCGCAGGTCAACCTGATCATGCACCACGCCGACTTCCAGCAAC
TGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAACTGAAGATCCG
TGTGCTGAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCACCTGGGACCAG
AGCCCGATCTTCAAGAAGCTCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTATGGCTGCCTGG
TCGGCGACTACTACTTCGACCAGTCGCCGCCGGACGTCGAGCTGCTCGGCGAGATGGCGAAGATCTCCGC
CGCCATGCATGCGCCGTTCATCTCCGCCGCCTCGCCGACGGTGATGGGCATGGGTTCCTGGCAGGAACTG
TCCAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGTTCGCTGCGCGAGT
CCGAGGACTCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGGGCGAAGAC
CGATCCGGTGGAAGAGTTCGCCTTCGAGGAAGAAACCGACGGCGCCGACAGCAGCAAGTACGCCTGGGCC
AACTCGGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCTCTACGGCTGGTGCTCGCGGATCC
GCGGCGTCGAGTCCGGCGGCGAGGTGCAGGGCCTGCCGGCGCACACCTTCCCCACCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATTTCCGACCGCCGCGAGGCGGAGCTGGCGAAGAACGGCTTC
ATGCCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAACCCG
CCGAGTACGACGATCCGGACGCCACCGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTGTTCGCCAG
CTGCCGCTTCGCCCATTACCTGAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAGGAGAAGGACGAG
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTATGTCGACGGCGACCCCGCCCACTCCACCGAGACCA
CCAAGGCCCAGCACCCGCTGGCGGCGGCCGAAGTGGTGGTGGAGGAAGTCGAAGGCAATCCGGGTTACTA
CAACTCGAAGTTCTTCCTTCGCCCGCACTACCAGCTCGAGGGACTGACGGTATCGCTACGCCTGGTATCC
AAGCTGCCTTCGGCCAAAGAGGCCTGA