SecReT6
Protein ID: 386063063
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0090
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]108031..108816 [+]
Productputative secretion protein
NoteTagJ
UniProt IDG4LC64
KEGG IDpnc:NCGM2_0090
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.30E-43, Aligned region: 139..256
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 2..54
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 112..130
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 6..62
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 111..131
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 2..39
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 36..53
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 93..121
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 3..51
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 102..119
Protein Sequence: 261 a.a.     [Download]
>gi|386063063|ref|YP_005978367.1| putative secretion protein [Pseudomonas aeruginosa NCGM2.S1]
MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTY
STAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAP
FAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVALLPARYAE
TVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|386062973|ref|NC_017549.1|:108031-108816 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGATCGCCGAAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGC
GCAGCCAGCCGTCGAACGCCACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGC
GCGGGCGCAGAACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTAC
TCCACCGCCATCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCG
GCCAGCCGGCGGAATGGATCGCGCCGCTGTTGCAGGCCCTGAGCCTGGATGCCGAAGGCCACGGCGAGGC
CGCCCAGGCCCTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGGCGGATCGGCGAGGCGCCG
TTCGCCTGGCTGGCGGATGCCGACACGCGCCTCGGTCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATG
CCTGGTTGCCGATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGACCTGGTCTG
GCTGCCGGCCGAACTGACCCTGGCCAACGGCGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAA
ACCGTCGAGCACGGAGACGACGCCGCGCGCCTGGGGCGCAAGACCGAATGGCTGGACAGCGGCCTGCCGG
TCGGCCAGCGGCTGTTCGTCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAGCTGGACTTCGA
GCCGACGGACGCCTGA