SecReT6
Protein ID: 386063064
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0091
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]108818..109327 [+]
Producthypothetical protein
NoteTssE
UniProt IDG4LC65
KEGG IDpnc:NCGM2_0091
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.70E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|386063064|ref|YP_005978368.1| hypothetical protein NCGM2_0091 [Pseudomonas aeruginosa NCGM2.S1]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVLRDLAWLFNTTSLFDPGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|386062973|ref|NC_017549.1|:108818-109327 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCCGAACTGACCCTCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAGCCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACCTCGCTGTTCGACCCCGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGCTGCGGGTGCGCGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGTGATCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA