SecReT6
Protein ID: 386063065
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0092
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]109324..111183 [+]
Producthypothetical protein
NoteTssF
UniProt IDG4LC66
KEGG IDpnc:NCGM2_0092
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-224, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|386063065|ref|YP_005978369.1| hypothetical protein NCGM2_0092 [Pseudomonas aeruginosa NCGM2.S1]
MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGALSSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWP
LEVAQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLG
NACAVFVRAPDNAWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRAL
RRCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFE
VHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSKQRRKGPRSTYVGSETFVALVD
ANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLAERGQGAAALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEIT
LDFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|386062973|ref|NC_017549.1|:109324-111183 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGAACCCGCGCCTGCTCGAGTACTACAACCAGGAATTGCAACACATCCGCGAAAGCGCCGCGGAGTTCG
CCGAGGAGTTCCCGAAGATCGCCGGGCGCCTGTCGCTGTCCGGCTTCGAGTGCGCCGACCCCTACGTCGA
GCGCCTGCTGGAAGGTTTCGCCTATCTCACCGCGCGGGTCCAGCTGAAGCTCGACGCGGAGTACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCACTACCTGGCGCCGACTCCGTCGATGACCGTGGTGC
AGCTGCGCCCGGACCCCAACGAAGGCGCCCTGAGCAGCGGCTTCAGCGTCGAGCGCGGGGCCTCCCTGCG
CGGCCAGCTCGGCCCCGATGACCAGACCGCCTGCGAATACCGCACCGCCCACCCGGTGACCCTGTGGCCG
CTGGAAGTGGCCCAGGCCGACTACTTCGGCAATCCCGCCGCGGTGCTCGGCCGCCTCGCCGCCAGCGAGC
CGCGGGCCAAGGCCGGCCTGCGCATCCGCCTGCGCAGCGGCGCCGGTATCCCGTTCGACAGCCTGTCGCT
GGACGCCCTGCCGCTCTACCTGCACGGCGCCGACGAACAACCCTACCGCCTCTACGAACAATTGCTCGGC
AACGCCTGCGCGGTGTTCGTCCGCGCCCCGGACAATGCCTGGGTCGAACGCCTGCCGACGAGCAGCCTGC
GTGCGCGCGGCTTCGACGACGAGGACGCGCTGCTGCCGGTGGTGCCGCGGGCGTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCGGCGCGCTTCCTGTTCGTCGAGTTCTCCGGCCTGAACCGCGCCCTG
CGTCGATGCCACGGCGAGGAGCTGGAACTGGTCGTGCTGTTCGGCAAGCACGACCAGCGCCTGGAGGGCA
CGGTGGACGCGGAGCAACTGGTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGCGCCGCTGCGACCG
CATCCACCTGTCCGACCGGGTCAACGAGCATCATGTGATCGTCGACCGCACCCGTCCGCTGGATTTCGAG
GTGCATTCGCTGCAACAGGTGAGCGGCCACGGCAGCGGTCCGGAGCAACCCTTCCAACCGTTCTACGCGG
TGCGCGACCCGGCGCGCTACGGCCGCGAGCAGGCCTACTTCAGCGTGCGTCGCGAACCGCGCGTGCTGTC
CAGCAAGCAGCGGCGCAAGGGCCCGCGCTCGACCTACGTCGGCAGCGAGACCTTCGTCGCCCTGGTCGAC
GCCAACCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGCATCGCCGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGCCGATCGGCGCGCACAAGAGCGACTTCACCCTGGAGGACAGCGCGCCGGTCATGCA
GGTGCGCTGCCTCGCCGGACCGAGCCGGCCGCGCGCCAGCCGTGCCCACGATGCCAGCGCCTGGCGGCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGTTGGCCGAGCGCGGCCAGGGCGCCGCCGCCCTGCGCGAGC
TGCTGCGGCTCTACGGCGACAGCGGCGATCCGGCGCTGCAACTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAGCCTTGCACGCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGTGGCCTGGAGATCACC
CTGGACTTCGACGAGAACGCGTTCCGCGGCACCGGGGTGTTCCTCCTCGGCGCCGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGCTGCGCACCGGCGAACGGGGCGAGGTGAT
GAGATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGA