SecReT6
Protein ID: 386063066
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0093
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]111147..112193 [+]
Producthypothetical protein
NoteTssG
UniProt IDG4LC67
KEGG IDpnc:NCGM2_0093
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.30E-112, Aligned region: 20..319
Protein Sequence: 348 a.a.     [Download]
>gi|386063066|ref|YP_005978370.1| hypothetical protein NCGM2_0093 [Pseudomonas aeruginosa NCGM2.S1]
MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLGHSVRLADDPLRLGQKPDCTFAPSTL
ASVSHTGTAATPRLDQFFFGLTGPNGPLPLHLTEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEA
RPEISHDRIDDDYWSARLAALSGRGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVA
VEEYVGQWLELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWV
AEYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPHEHKEKEHE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|386062973|ref|NC_017549.1|:111147-112193 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGAACCTGCTCGCCGGGATGGCGGCGGCGCCCTGGG
ACTATGACTTCTTCCAGGCGCTGCGGCGCATCGAGTGCGAGTCGCCGCAACTGCCGCGCCTCGGTCATTC
GGTGCGGCTGGCGGACGATCCGCTGCGCCTCGGGCAGAAGCCCGACTGTACCTTCGCGCCTTCGACCCTG
GCCTCGGTGAGCCACACCGGCACCGCCGCGACGCCGCGCCTGGACCAGTTCTTCTTCGGCCTCACCGGCC
CCAACGGGCCGCTGCCGCTGCACCTCACCGAATACGCCCGGGAACGCCAGCGCAACGTCAACGACGCGAC
CTTCAAGCGCTTCATGGACGTCTTCCACCACCGCCTGCTGACCCTGTTCTACCGGGCCTGGGCGGAGGCG
CGGCCGGAGATCAGCCACGACCGGATCGACGACGACTACTGGTCGGCGCGCCTCGCCGCGCTCTCCGGGC
GCGGCATGCCGAGCCTGCGGGGGCGCGAGCCGCTGGCGGACACCGCGCGCTACTACTACACCGGCCACCT
CGCCGCGCAGACCCGCTACCCGGACGGCCTGCGGGTGATCCTCGCGGAGTATTTCGAGGTCCCGGTGGCG
GTCGAGGAATACGTCGGCCAATGGCTGGAGCTGCCCGAGCGCAGCCGCCTCGGCGTCGACTCGACGAGCC
TGGGCATGGACGTCTGCCTGGGCACCCACGTCTGGGACCGCCAGCACAAGTTCCGCCTGCGCCTGGGGCC
GCTGGACCTCGATCAATACCAGCGCTTCCTGCCCGACGGCGACCACTTCGTCGAGCTGGCCGCCTGGGTC
GCCGAATACCTGGGCGAGGAGCTGGACTGGGACGTCAACCTGGTCCTGCAACGCCACGAAGTACCCCCGC
TGGGCCTGCAGGGCGGCGGGCGGCTCGGTTTCAACACCTGGCTGGGCGATCCCGGCCAGGACGCCAGGGA
TCTACTGCTGGCCCGCCAGTACGCCACTGCGCGGCCGCACGAGCACAAGGAGAAGGAACATGAGTGA