SecReT6
Protein ID: 386063068
SecReT6 ID614
T6SS typei3
Gene symbol-
Locus tagNCGM2_0095
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]114932..116872 [+]
Producthypothetical protein
NoteTssI
UniProt IDG4LC69
KEGG IDpnc:NCGM2_0095
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.80E-88, Aligned region: 29..329
Phage_base_V [PF04717], Evalue: 2.00E-26, Aligned region: 369..462
Protein Sequence: 646 a.a.     [Download]
>gi|386063068|ref|YP_005978372.1| hypothetical protein NCGM2_0095 [Pseudomonas aeruginosa NCGM2.S1]
MGLMQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSR
RFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRP
YREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRER
DHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIE
AIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCM
DASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVT
GTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQG
TIDGQVQAMFPPPAKG
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|386062973|ref|NC_017549.1|:114932-116872 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGGATTGATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGC
AGCGCATGGAGGGACGCGAGGAACTGGGACGGCTGTTCGCCTACGAGCTGCACCTGGTATCGGAAAATCC
CAACCTGCCGCTGGAGCAGTTGCTCGGCAAGCCGATGAGCCTGTCGCTGGAGCTGCCCGGCGGCAGCCGG
CGCTTCTTTCACGGTATCGTCGCGCGCTGTAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGG
CCACCCTGCGGCCCTGGCCGTGGCTGCTGACGCGCACCTCGGACTGCCGCATCTTCCAGAACCAGAGCGT
GCCGGAGATCATCAAGCAGGTGTTCCGCGACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAAC
AGGAGGGCATCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCATCGCAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCAGATGGCGCGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCC
GCTGTACGACTATCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAG
GCGATCCAGGCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGTGGGATCGGCGCCGGACACCTGT
TCCGCCTGAGCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGT
GGTCCAGGAACTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATG
GACGCCAGCCAGTCGTTCCGCCTCCTGCCGCAGACCCCGGTGCCGGTGGTGCGCGGTCCGCAGACCGCGG
TGGTGGTCGGTCCCAAGGGCGAGGAGATCTGGACCGACCAATACGGCCGGGTCAAGGTGCATTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACG
ATGCCTCGCTGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCAA
CAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGTTGGTGGGCGGGGCGAAGAGCGACAGCGTCACC
GGCACCTACCTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACG
CCGACGGCACCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACAC
CGGCGGCCGCCTCGACCTCAATTCCGGCGGTGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGC
ACCATCGACGGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA