SecReT6
Protein ID: 386065491
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2552
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2732174..2734210 [-]
Producthypothetical protein
NoteTssI
UniProt IDG4LBC3
KEGG IDpnc:NCGM2_2552
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-70, Aligned region: 29..322
Phage_base_V [PF04717], Evalue: 1.70E-27, Aligned region: 371..464
Phage_base_V [PF04717], Evalue: 1.70E-27, Aligned region: 477..489
Protein Sequence: 678 a.a.     [Download]
>gi|386065491|ref|YP_005980795.1| hypothetical protein NCGM2_2552 [Pseudomonas aeruginosa NCGM2.S1]
MFAAANQTHFSLAIDGLALDLQVLSFSGREAISQPFAFDLELVGERPVPDLESLLHKPAFLTLGPAGNGI
HGLVRSAGQGDSGKRLTRYRITLVPQLAYLAQRTNQRIFQHLTVPQIVGRVLEEHGILADAYRFQLGTRY
PEREYCVQYDESDLQFVQRLCCEEGIHFHFQHSATAHLLVFGDDQTVFPRLAPVAYQQDSGLVADRPAVK
RFGVRLETRTSRVTRRDYDFEKPRLTLESAARGEARPDLEDYDYPGRFVDRERGKHLARRALERQRSDYR
LAEGRSDQPLLLSGHFLPLAAHPQAGWNDLWLLTEVIHEGRQPQVLEESIVSDTSASPDDFRQGYRNRFQ
ATPWEAFFRPPPTPPKSRILGTQSAVVTGPKGEEIHCDRYGRVKVQFHWDREGQADDSSSCWLRVASGWA
GKNYGAIAIPRVGMEVLVTFLEGDPDQPLVTGCLFHREHPVPYELPAHKTRSVFKSLSSPWRRWLQRAAH
RGPQGPGADLRPCPARLGRKHRARPEDPRRSPTPRHREGEQLQRVQGRGTPHHPRRAQGGGPRQRPPHRS
QRPAPEDRQRPVCRGRPGDPPEQRPEGGAGGRRRTDPQGRWQLPQARRQRRDPLRGQRPGQLRRQPGQRQ
RRGAAVAGAAAAGRQRQGRRPPHPGPDQYPEAQRALLRRVREVQGRCL
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c2734210-2732174 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGTTCGCAGCAGCCAACCAGACCCACTTCAGCCTCGCCATCGACGGCCTCGCCCTCGACCTGCAGGTGC
TCTCCTTCAGCGGCCGCGAAGCCATCAGCCAGCCGTTCGCCTTCGACCTGGAGCTGGTCGGCGAACGCCC
CGTGCCGGACCTCGAAAGCCTGCTGCACAAACCCGCCTTCCTTACCCTCGGGCCCGCCGGCAACGGTATC
CACGGCCTGGTGCGCAGCGCCGGACAGGGCGACTCGGGCAAGCGCCTGACCCGCTACCGCATCACCCTCG
TCCCGCAACTGGCCTACCTCGCCCAACGCACCAACCAGCGCATCTTCCAGCACCTCACGGTGCCGCAGAT
CGTCGGCCGGGTGCTGGAGGAACACGGCATCCTCGCCGACGCCTACCGCTTCCAGCTCGGCACCCGCTAC
CCCGAGCGCGAATACTGCGTGCAGTACGACGAGAGCGACCTGCAGTTCGTCCAGCGCCTGTGCTGCGAGG
AGGGCATCCACTTTCATTTCCAGCACAGCGCCACGGCGCACCTGCTGGTGTTCGGCGACGACCAGACGGT
GTTCCCGCGGCTCGCGCCGGTGGCCTACCAGCAGGACTCCGGCCTGGTCGCCGACCGGCCGGCGGTCAAG
CGCTTCGGCGTACGCCTGGAAACCCGCACCAGCCGCGTCACCCGCCGCGACTACGACTTCGAGAAACCGC
GCCTGACGCTGGAAAGCGCCGCCCGCGGCGAAGCCCGGCCGGACCTCGAGGACTACGACTATCCCGGTCG
CTTCGTCGACCGCGAGCGCGGCAAGCACCTGGCCAGGCGTGCCCTCGAACGGCAGCGCAGCGACTACCGC
CTGGCCGAGGGCCGCAGCGACCAACCGTTGCTGCTCAGCGGCCACTTCCTGCCGCTGGCCGCCCATCCCC
AGGCGGGCTGGAACGACCTCTGGCTGCTCACCGAGGTGATTCACGAGGGGCGGCAGCCGCAGGTGCTGGA
AGAAAGCATCGTCTCCGACACCTCGGCGAGCCCGGACGACTTCCGGCAGGGTTACCGCAACCGCTTCCAG
GCCACGCCCTGGGAGGCGTTCTTCCGTCCCCCGCCGACGCCGCCAAAGTCGCGCATCCTCGGCACGCAGA
GCGCGGTGGTGACCGGCCCGAAGGGCGAGGAAATCCACTGCGACCGCTACGGTCGGGTGAAGGTGCAATT
CCACTGGGATCGCGAGGGCCAGGCCGACGACAGCAGCAGTTGCTGGTTACGCGTTGCCTCCGGCTGGGCG
GGAAAGAACTACGGCGCCATCGCCATCCCGCGGGTCGGCATGGAGGTGCTGGTGACCTTCCTCGAAGGCG
ATCCCGACCAGCCGCTGGTCACCGGCTGCCTGTTCCACAGGGAACATCCGGTGCCCTACGAACTGCCGGC
GCACAAGACCCGCAGCGTCTTCAAGAGCCTCAGCAGTCCCTGGCGGCGGTGGCTACAACGAGCTGCGCAT
CGAGGACCGCAAGGGCCAGGAGCAGATCTTCGTCCATGCCCAGCGCGACTGGGACGAAAACATCGAGCAC
GACCAGAAGATCCGCGTCGGTCACCAACGCCACGACACCGTGAAGGCGAACAGCTACAGCGAGTTCAAGG
CCGAGGAACACCGCACCACCCACGCCGAGCGCAAGGTGGAGGTCCGCGCCAGCGACCACCTCACCGTAGC
CAACGACCAGCACCTGAAGATCGCCAGCGGCCAGTTTGTCGAGGCCGGCCAGGAGATCCACCTGAGCAGC
GGCCTGAAGGTGGTGCTGGAGGCCGGCGCCGAACTGACCCTCAAGGGCGGTGGCAGCTTCCTCAAGCTCG
ACGCCAGCGGCGTGACCCTCTCCGGGGCCAACGTCCGGGTCAACTCCGGCGGCAGCCCGGGCAGCGGCAG
CGGCGCGGCGCCGCTGTTGCCGGGGCCGCTGCGGCAGGCCGACAGCGACAAGGCCGGCGCCCTCCTCACC
CCGGCCCAGATCAATACCCTGAAGCGCAACGCGCCCTTCTGCGAAGAGTGCGAGAAGTGCAAGGACGGTG
CCTGTGA