SecReT6
Protein ID: 386065493
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2554
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2735622..2737178 [+]
Producthypothetical protein
NoteTssA
UniProt IDG4LBC5
KEGG IDpnc:NCGM2_2554
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-22, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|386065493|ref|YP_005980797.1| hypothetical protein NCGM2_2554 [Pseudomonas aeruginosa NCGM2.S1]
MTYSSKLSSHYLELAEQPISKDVFAGEDVRFSSEYEALENELGKALSLHENGQTDWLKILENSEALLRAQ
SKDLRVAAWLTWALYQRESFPGLLAGLGLLERLCSRHWVEIHPLKARTRAAAIAWLVPRLEQALNENVPI
KEQLPLFRRLAEHLEKLDTALATQLGDDAPLLLPISRRLSGMLQRAADNQPEPGVVGAVVAQVKQAASQL
LAPGAPIDNERDAHKAMRAQQEAARPLCAWWLKQKATDLRALRLNRTMLWLPIESMPERNAEQVTALRGV
PADKLKSYQERFAQGLYADLLVELEASLARAPFWFDGQRLVWECLQGLNAEQAMREVEMHFALLLQRLPG
LVELRFHDGSAFADAATRGWISAHVMPHLQNDSAPRKVETVALQAEWDVALDEVQPVLRKDGLKAAVQVL
KQGMKRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDHQLHESGLHAWEPDLALDVLHLLHSCCEL
LPQNHAVRERKEDIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2735622-2737178 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGACCTATTCGAGCAAGCTCTCCTCGCATTATCTGGAACTCGCGGAACAGCCGATTTCAAAGGATGTCT
TTGCGGGTGAGGATGTGCGTTTTTCCAGCGAATACGAGGCGCTGGAAAATGAGCTGGGCAAGGCGCTCTC
GCTCCATGAGAACGGCCAGACCGACTGGTTGAAAATCCTGGAAAACAGCGAAGCGCTGCTTCGTGCCCAA
TCCAAGGACCTGCGTGTTGCAGCCTGGTTGACCTGGGCCCTCTACCAACGGGAATCCTTTCCCGGTTTGC
TGGCCGGACTGGGATTGCTGGAACGTCTGTGCAGCCGGCATTGGGTCGAGATCCATCCGCTCAAGGCGCG
CACTCGCGCCGCGGCCATTGCCTGGCTGGTGCCCCGGCTGGAGCAGGCGCTGAACGAGAACGTACCGATC
AAGGAGCAACTCCCCCTGTTCCGGCGTCTCGCCGAGCACCTGGAAAAACTCGATACCGCGCTGGCCACGC
AACTGGGCGACGACGCGCCCTTGTTGCTGCCGATCAGCCGACGCCTTTCGGGCATGCTCCAGCGCGCCGC
CGACAACCAGCCCGAACCTGGCGTGGTCGGCGCCGTGGTGGCCCAGGTCAAGCAGGCGGCCAGCCAGTTG
CTGGCGCCGGGTGCGCCCATCGACAACGAGCGCGACGCCCACAAGGCCATGCGCGCCCAGCAGGAGGCCG
CACGCCCCCTGTGCGCCTGGTGGCTGAAGCAGAAAGCCACCGATCTGCGCGCGCTGCGCCTCAACCGGAC
GATGCTCTGGCTGCCCATCGAGTCCATGCCCGAGCGCAATGCCGAACAGGTCACCGCGCTAAGGGGAGTG
CCGGCGGACAAGCTGAAAAGCTACCAGGAGCGTTTCGCCCAGGGCCTGTACGCCGATCTCCTGGTGGAGC
TGGAGGCGAGCCTGGCACGGGCGCCGTTCTGGTTCGACGGCCAGCGCCTGGTCTGGGAGTGCCTGCAAGG
GCTCAACGCCGAGCAGGCGATGCGGGAAGTCGAAATGCATTTCGCCTTGCTCCTGCAGCGTCTGCCGGGG
CTGGTGGAGCTGCGTTTCCACGACGGCAGCGCATTCGCCGATGCGGCCACCCGTGGCTGGATCAGCGCCC
ATGTCATGCCCCATCTCCAGAACGACAGTGCGCCGCGCAAGGTCGAGACCGTGGCCCTGCAGGCCGAATG
GGACGTCGCCCTGGACGAGGTCCAGCCGGTGTTGCGCAAGGACGGCCTGAAGGCGGCGGTACAGGTGTTG
AAGCAGGGCATGAAGCGCGCCCACGGCGGGCGCGCCCGGTTCTTCTGGCAACTGAGCCTCGCGCGACTGT
GCTTCCTGGCGAAGAAGTACGAGCTGGCCAAGACCCAGCTGGAGAGCCTCGACCATCAGTTGCACGAATC
GGGATTGCACGCCTGGGAGCCCGATCTGGCGCTGGATGTACTGCACCTGCTGCATAGCTGCTGCGAGCTG
TTGCCGCAGAACCACGCCGTGCGAGAACGCAAGGAAGACATTTATCGCAGGCTGTGCCACCTCGATCTCG
AGGTGGTGCTCGAATAG