SecReT6
Protein ID: 386065496
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2557
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2739236..2739643 [+]
Producthypothetical protein
NoteTssE
UniProt IDG4LBC8
KEGG IDpnc:NCGM2_2557
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|386065496|ref|YP_005980800.1| hypothetical protein NCGM2_2557 [Pseudomonas aeruginosa NCGM2.S1]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSNVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVTVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2739236-2739643 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGACCGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCAACGTGCGTGTCGTTTCCC
TGCCGCGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAAGGTTTCAA
GCGCCAGGTGAGTTTCTCCGCATGCCTGGATGGCAGCGGCCAAGTGACGGTCAGCTAA