SecReT6
Protein ID: 386065497
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2558
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2739975..2741762 [+]
Producthypothetical protein
NoteTssF
UniProt IDG4LBC9
KEGG IDpnc:NCGM2_2558
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-184, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|386065497|ref|YP_005980801.1| hypothetical protein NCGM2_2558 [Pseudomonas aeruginosa NCGM2.S1]
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSM
MHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYSV
TGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRPLDGVAGK
PMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRG
LELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVT
GWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVILE
TYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2739975-2741762 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
GTGTCCTTCAATCATTACTACCAGAGCGAACTCACCGCACTGCGCCAGCTGGGGCGCCGTTTCGCCGAGC
GTAGCCCGGCCCTGGCCCCGTTTCTCGGGCAGGTCGGACGCGATCCGGATGTCGAGCGCCTGCTCGAGGG
CTTTGCCTTCCTGACCGGGCGGTTGCGGCAGAAGCTGGACGACGAGTTGCCGGAACTCAGCCACTCGATG
ATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCCTGA
CCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGTCGC
CTGTCGCTTCCGTACCTGCTACGCCACCGAGGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCGGTG
ACCGGCGAAGGCGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCACCTCGGCGAGCTGGGCC
TGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCTGCG
CAACCTGGAGAGCATCCAGCTGATTCCGCTGGACGCCCATGGGCGGCCGCTGGATGGCGTGGCCGGCAAG
CCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGTTTCGCCGAAGACGAGGCGTTGATTC
CCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAGTACTTCGCGTTCCAGGACAAGTTCCT
GTTCGTCGACGTGGATGGCCTGGACCTGCTCGGCGCGCTGCCCGAGGAAACCCTCAAGCAGGTCCGCGGC
CTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCAAGC
TGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCAGGA
CGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAAGGCGTCACT
GGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCTTACGTACCGTTCGAGTCCTTCGAGCACGATCCCAGCT
TCGACGTTCCCGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCTGGA
CACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGCACC
AACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCCTGCGAAGGCACGCCGGAGTTCC
TCGGTTTCCGCAATATCACCCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTGGAA
ACTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCGCTCAAGGTGATCCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGCTCA
AGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGAGCT
GACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAATTT
TTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGTACC
AATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA