SecReT6
Protein ID: 386065498
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2559
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2741726..2742733 [+]
Producthypothetical protein
NoteTssG
UniProt IDG4LBD0
KEGG IDpnc:NCGM2_2559
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-88, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|386065498|ref|YP_005980802.1| hypothetical protein NCGM2_2559 [Pseudomonas aeruginosa NCGM2.S1]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLREEYPGLGDEALYDQLEFQANPSLGFPGSDVDRVE
FFEERGMLRARLRFNLIGLFGASSPLPAFYSEQALGDSEEGNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFALVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELVAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRHEEIREFRIGAQNACRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2741726-2742733 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGCTGGCCCGGGGCATTCGCGAGTACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGCCTGCGCGAGGAATATCCCGGCCTGGGAGACGAGGCGCT
CTACGATCAGTTGGAATTCCAGGCCAATCCTAGCCTCGGCTTCCCGGGCAGCGATGTCGATCGGGTGGAG
TTCTTCGAAGAGCGCGGCATGCTGCGGGCGCGGCTGCGTTTCAACCTGATCGGCTTGTTCGGTGCCAGTT
CGCCGTTGCCGGCGTTCTACAGCGAGCAGGCTCTGGGCGACAGCGAGGAGGGCAATCCTACGCGGAACTT
CCTCGATCTCTTCCATCACCGCCTGCATCGGCTGCTGTTGCCGATCTGGCGCAAGTACCGTTACCGGGTG
AGCTTCCAGAGCGGTGCGAGCGATGCGTTCTCCGCTCAGTTGTTCGCCCTCGTCGGATTGGGCGGGGAAG
AGATCCGCAAAGCCAGGGAACTGAACTGGAAACGCCTGCTGCCCTACCTGGGCCTGCTCAGCCTGCGGGC
GCACTCGGCGGCCTTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCATGCCGAACTGGTCGCCGAGCAG
TGTATCGAACGGCGCGTCGCGATCCTCGAAGAGCAGCGCAACCGACTCGGCCTGTTCAACAGCCAGCTTG
GCGAAGACGCGGTGCTGGGCGAACGGGTCCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGACTGGCAGCGCTTCCACGAGTTCCTGCCGATCGGTCCCGGCTACCAGCCGCTTTGCGCGCTGGTCCGC
TTCACCCTGCGCGACCCGCTCGACTACGACATCCGGCTGGTCTTGCGCCACGAGGAAATCCGCGAGTTCC
GCATCGGCGCGCAGAACGCCTGCCGCCTTGGCTGGACCAGTTGGCTGGGCCGGGAGCGCGCCGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA