SecReT6
Protein ID: 386065503
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2564
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2748332..2748847 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDG4LBD5
KEGG IDpnc:NCGM2_2564
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-42, Aligned region: 22..157
Protein Sequence: 171 a.a.     [Download]
>gi|386065503|ref|YP_005980807.1| putative lipoprotein [Pseudomonas aeruginosa NCGM2.S1]
MIAMSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHP
VAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPV
TAKELTRVELKLGRKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2748332-2748847 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGATCGCCATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGC
TGGCCGGCTGTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGA
GCGGGTCAATCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAGCACCCG
GTGGCGTTCGAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGG
TGACCAGCGAGGAGCTGGAGCTGCGGCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGAGGAGGGGAG
CCGCTACGTGGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTC
ACGGCGAAAGAGCTGACCCGGGTAGAGCTGAAGCTGGGCCGGAAGGGCATCCTGAATGCCGGCGAACTGC
TCGGCAAGGCGGGTGACGCGCGATGA