SecReT6
Protein ID: 386065504
SecReT6 ID615
T6SS typei1
Gene symbol-
Locus tagNCGM2_2565
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2748844..2750175 [+]
Producthypothetical protein
NoteTssK
UniProt IDG4LBD6
KEGG IDpnc:NCGM2_2565
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|386065504|ref|YP_005980808.1| hypothetical protein NCGM2_2565 [Pseudomonas aeruginosa NCGM2.S1]
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLVISQASGVLPD
GSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLARYTAYDLEVADSNAGEDSMV
QVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVISLDPDFVPSYLHAHASAYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESK
RPRLDSRYQHSDQGASFRRLMEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASA
NCESEELRQRLPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMTQLERS
GGFAFHVSGEFSELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2748844-2750175 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGAACGTGCACAAGATCGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACCTGCAACACAACGACC
GCTACTACGACAACCAGATGAAGGCCCGGACCCAGTTGCTGGGCAGCTACAACTGGGGCTTCCTCGCCCT
GGAGCTGGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGATCAGCCAGGCCTCCGGCGTACTGCCCGAC
GGCAGCCTGTTCGAACTCGGCGGCAACACCGAGCCGCTCGCCCTCGACGTGCCGCCCAATACCTCGAACG
TGCCGATCTACCTGGCCCTGCCGCTGGTCACCGGTAACCACATCGAGGCGCGCCGGCCGGAGCAGGCCGA
GGTCCTGGCGCGCTATACCGCCTACGATCTGGAGGTGGCGGACTCCAACGCCGGCGAGGATTCCATGGTG
CAGGTCAGCTGCGCGCGGCCGGATTTTCGCCTGCTGCTCGGCGAGCAGCAGAGCGACCAGGCCTACGTCA
AACTGAAGGTGGCGGTGGTGCTGGATACCACGCCGGACGGGGTGATCAGCCTCGACCCCGACTTCGTGCC
GAGCTACCTCCACGCCCACGCATCCGCCTACCTGCTGTCCTGCCTGAAGGAGGTGATTAGCATGCTCGGC
CATCGCGGCGACACCATCGCCGAGCGTATCCGGTCCAATGGCAAGGTCGGCGGCGCGGAGGTCGGCGATT
TCATGATGCTGCAACTGATCAATCGCACCGAGTTGCTGCTGCGCCACTACCTGGGATTGGAGCAGGTGCA
TCCGGAGCAGTTGTACCGGGTGCTGCTGACCATGCTCGGCGACCTCGCCACCTTCGGCAGCGAGAGCAAG
CGTCCGCGCCTGGACAGCCGTTACCAGCACAGCGACCAGGGCGCCAGCTTCCGCAGGCTGATGGAGGCGA
TTCGCCAGGTCCTGTCGATGGTGCTCGAGCAGCATGCCATCGAACTGCCTCTCCAGGCCCGCCAGTACGG
CATCCTGGTCTCGCCCCTGCACGACCACAAGCTGCTCGGCAGCGCCTCGTTCGTGCTCGCCGCCAGTGCC
AATTGCGAGTCGGAGGAACTGCGCCAGCGCCTGCCCGCGCATCTCAAGGTGGGTGCGGTCGAGCACATTC
GCCAGTTGGTCAACCTGCACCTGCCGGGGATCCGGGTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACTCCAACAAGACCTATTTCATTCTCGAACCCAACGCCGAGGATATGACCCAGCTGGAGCGCTCC
GGCGGTTTCGCGTTCCACGTATCCGGCGAGTTCTCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA