SecReT6
Protein ID: 386066298
SecReT6 ID616
T6SS typei4a
Gene symbolsfnR
Locus tagNCGM2_3369
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3604224..3605309 [-]
Productputative transcriptional regulator
NoteSfa3
UniProt IDG4LI81
KEGG IDpnc:NCGM2_3369
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 9.70E-69, Aligned region: 22..188
Sigma54_activat [PF00158], Evalue: 9.70E-69, Aligned region: 300..308
Sigma54_activ_2 [PF14532], Evalue: 3.60E-21, Aligned region: 26..192
AAA_5 [PF07728], Evalue: 5.40E-09, Aligned region: 46..162
AAA_5 [PF07728], Evalue: 5.40E-09, Aligned region: 262..302
Mg_chelatase [PF01078], Evalue: 0.00016, Aligned region: 42..65
Mg_chelatase [PF01078], Evalue: 0.00016, Aligned region: 100..163
AAA [PF00004], Evalue: 0.00046, Aligned region: 46..162
HTH_30 [PF13556], Evalue: 0.0014, Aligned region: 315..347
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 243..259
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 308..343
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 35..83
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 280..298
AAA_2 [PF07724], Evalue: 0.0091, Aligned region: 42..141
Protein Sequence: 361 a.a.     [Download]
>gi|386066298|ref|YP_005981602.1| putative transcriptional regulator [Pseudomonas aeruginosa NCGM2.S1]
MSVITHPHARELTKSVRATVLVFNDPRSRELLERIERLAPSEANALVIGETGTGKELVARHIHALSGRSG
GPFVAVNCGAFAESLVESELFGHEKGAFTGALQSKAGWFEAANGGTLFLDEIGDLPPSIQVKLLRVLQER
EVVRLGSRRPIPIDVRLVAATNVDLADAVVAGHFREDLFYRLHVATIQLPPLRERRGDILPLAEYFIVEH
CRRLGYTSASLSPEAERKLLGHSWAGNIRELENAIHHALLVCRNRLIQPADLHLIDMRARQEPSGLRRAP
ESAAGSALEAALQALFEENREDLYEHIEETVFRAAYRFCHGNQLQTGRLLGISRNIVRARLEKIGELETS
PRHNVVSLVGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c3605309-3604224 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGTCCGTCATCACCCATCCCCACGCCCGCGAGCTGACCAAATCGGTGCGCGCCACCGTGCTGGTGTTCA
ACGACCCCCGTTCCCGCGAGCTGCTGGAGCGCATCGAGCGCCTGGCGCCCAGCGAGGCCAACGCGCTGGT
CATCGGCGAGACCGGCACCGGTAAGGAGCTGGTGGCGCGCCATATCCATGCCCTCAGCGGACGCAGCGGC
GGCCCGTTCGTCGCGGTCAACTGCGGTGCTTTCGCCGAGAGCCTGGTGGAGAGCGAGCTGTTCGGCCACG
AGAAGGGCGCCTTTACCGGTGCGTTGCAGAGCAAGGCCGGCTGGTTCGAGGCGGCCAACGGCGGCACCTT
GTTCCTCGACGAGATCGGCGACCTGCCGCCGAGCATCCAGGTCAAGCTGCTGCGCGTGCTGCAGGAGCGC
GAGGTGGTGCGGCTCGGTTCGCGCCGGCCGATCCCCATCGACGTGCGGCTGGTGGCGGCGACCAACGTCG
ACCTGGCCGACGCGGTGGTCGCCGGGCACTTCCGCGAGGACCTGTTCTACCGCCTGCACGTGGCGACCAT
CCAACTGCCGCCGTTGCGCGAGCGCCGCGGCGATATCCTGCCGCTGGCCGAGTACTTCATCGTCGAGCAC
TGCCGGCGCCTCGGCTACACCAGCGCGAGCCTGAGCCCGGAAGCCGAGCGCAAGCTGCTCGGGCATTCCT
GGGCGGGCAATATCCGCGAGCTGGAGAACGCCATCCACCACGCGCTGCTGGTCTGCCGCAACCGCCTGAT
CCAGCCGGCCGACCTGCACCTCATCGACATGCGTGCGCGCCAGGAGCCGAGCGGCTTGCGCCGCGCCCCC
GAGAGCGCCGCCGGCTCGGCGCTGGAAGCGGCGCTGCAGGCACTGTTCGAGGAAAACCGCGAGGATCTCT
ACGAGCACATCGAGGAAACCGTGTTCCGCGCCGCCTATCGCTTCTGCCACGGCAACCAGTTGCAGACCGG
ACGCCTGCTGGGGATCAGCCGCAACATCGTGCGCGCCCGCCTGGAGAAGATCGGCGAGCTGGAAACCTCG
CCACGACACAACGTGGTCTCGCTGGTGGGCAAGTGA