SecReT6
Protein ID: 386066299
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3370
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3605419..3606519 [-]
Producthypothetical protein
NoteTssA
UniProt IDG4LI82
KEGG IDpnc:NCGM2_3370
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 213..229
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 248..262
Protein Sequence: 366 a.a.     [Download]
>gi|386066299|ref|YP_005981603.1| hypothetical protein NCGM2_3370 [Pseudomonas aeruginosa NCGM2.S1]
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLQRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLPEEQPPVAEADAAEG
DADGEESVPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c3606519-3605419 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGC
CGTGTGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAGGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGATCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCCTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTCGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTGCAACGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCGCTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGCCCGAAGAACAGCCACCGGTCGCGGAGGCGGACGCCGCCGAAGGC
GACGCGGACGGCGAGGAAAGCGTCCCGGCGAGCGCGCCGAGCGGGCCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTATCGGCAACTGCTGCTGATCGCCGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAATGGGGCAACAAGCCGCTGAGCGAGCTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGGGTCTGGTCGCTGCTTGGCGTACTGCCCTAA