SecReT6
Protein ID: 386066301
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3372
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3610328..3611086 [-]
Producthypothetical protein
NoteTssL
UniProt IDG4LI84
KEGG IDpnc:NCGM2_3372
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.70E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|386066301|ref|YP_005981605.1| hypothetical protein NCGM2_3372 [Pseudomonas aeruginosa NCGM2.S1]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQEKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c3611086-3610328 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAGCCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGCGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATTACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGAAAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGCTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCTGCCGCCGCGCCGCCACGGCGCCTGCCGGTGCGCGCGGCGCTGCCGGACGGT
TTCCGCCTGGGCCTGGCGGTGCTCGGCCTGGTGCTGCTGATGAGCGGCATCGGGCACCTGTTCTGGCGCG
ACATCCAGCATGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA