SecReT6
Protein ID: 386066302
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3373
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3611104..3612396 [-]
Producthypothetical protein
NoteTssK
UniProt IDG4LI85
KEGG IDpnc:NCGM2_3373
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-69, Aligned region: 7..398
Protein Sequence: 430 a.a.     [Download]
>gi|386066302|ref|YP_005981606.1| hypothetical protein NCGM2_3373 [Pseudomonas aeruginosa NCGM2.S1]
MQLLPQHFQLQGLRAEALAARTGQACNPWFWGVTALELDPSALCAGQVRVLHLEAILPDGLPVSVQAGVD
APLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEHPEPITVWRASLRL
VGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLVLPESPLGRRVQSLCARAREKALFLGGRLRLAQQA
GNQDDAVEVRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGVPAFEALDFLDLRR
GYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGEQAAADWLERAIVA
SDPHLPLLARQRMSGLARQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVAPVCGVASSPWQIV
LFVADGSDNT
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c3612396-3611104 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGCAACTGCTTCCCCAGCATTTCCAGTTGCAGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCACCGGAC
AGGCCTGCAACCCTTGGTTCTGGGGCGTGACCGCCCTGGAACTGGACCCCTCGGCGTTGTGCGCCGGCCA
GGTGCGGGTCCTGCACCTCGAAGCGATCCTGCCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGAC
GCACCGCTGGAGTTCGACCTGGAGACTGCGCTGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGG
CGGTCAGTCCGCTGTGGCGGGCGGGTCAGTTGCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGC
GCCGCTGCCGGACCTGGCCAGCGGCGAGCACCCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTG
GTCGGCGACGACGGCAAGGCCGACTCCGTGTGCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCT
ATGTCAGCCTGCCCTACGTCCCGCCGACGCCATTGGTGCTGCCGGAGTCGCCCCTGGGCAGGCGCGTGCA
GTCGCTCTGCGCGCGGGCCCGGGAGAAGGCGCTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCG
GGTAACCAGGACGACGCCGTGGAAGTCCGTCGCCAGCTCGCCGCGCTCTGGACCCGCCTGCCGGAGGTGG
AAGGCCTGCTGGCAAGCCGCGCGGCCTCGCCGCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGGGC
CTGGGCGGCGCTCGATCCGCTGGCCGGCGTGCCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGT
GGCTACGAGCCGCTGCTGGACTGGCTGGAGCGCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGC
CGTTCGAGCAGGAGGAACAGGTGTTTTCCGTGCGCCTGCCCGATCCGGCGCCGCGCCAGCGCCTGGTGGT
CGGCCTGCGGATGCCCGCCGGCGCCGGCGAACAAGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCC
TCCGATCCGCACCTGCCGTTGCTCGCCCGGCAGCGCATGAGCGGGCTGGCGCGGCAGCCGATGAATCGCC
AGGAACAGGTGGCCTACAGCGTCGGCGACGACACCCGTTTGTTCGTCGTGCAGGGCGCCGGCGACTGGTT
CGATGCCGGCCAGCCGCTGCGCATCGTCGCGCCGGTCTGCGGGGTTGCCAGCAGTCCCTGGCAGATCGTG
CTGTTCGTCGCCGACGGCAGCGACAACACCTAG