SecReT6
Protein ID: 386066304
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3375
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3613179..3613724 [+]
Producthypothetical protein
NoteTssB
UniProt IDG4LI87
KEGG IDpnc:NCGM2_3375
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-52, Aligned region: 9..161
Protein Sequence: 181 a.a.     [Download]
>gi|386066304|ref|YP_005981608.1| hypothetical protein NCGM2_3375 [Pseudomonas aeruginosa NCGM2.S1]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNE
ILSSISPRATLQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDD
LDQLLQDVVANTEGLQEIKAARPEAEAAPAGDSEPPADQPA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|386062973|ref|NC_017549.1|:3613179-3613724 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTGGACCGGGTGCGCCCGCCGCGCGTGCAGATCACCTACGACGTCG
AGATCGGCAACGCCATCGAGAAGAAGGAGCTGCCCCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGATACCCCGCCGGCGAAGCTGGTCGAACGGCGTTTCGTCGACATCGACCGCGACAACTTCAACGAG
ATCCTCTCCTCCATCTCTCCCCGCGCCACCCTGCAGGTCGACAACACCATCAGCGGCGACGACAGCAAGC
TGAACGTCGAGCTGCGCTTCAACCACATAGAGGACTTCGACCCGGTCAACCTGGTGAAGCAGGTGGTCCC
GTTGCGTCGCCTGTTCGAGGCGCGCCAGCGCCTGCGCGACCTGCTGACCAAGCTCGACGGCAACGACGAC
CTCGACCAGCTGCTGCAGGACGTGGTGGCCAACACCGAAGGCCTGCAGGAAATCAAAGCGGCCCGCCCGG
AAGCCGAAGCGGCCCCGGCCGGTGACAGCGAACCCCCGGCCGACCAGCCGGCCTGA