SecReT6
Protein ID: 386066307
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3378
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3615815..3616240 [+]
Producthypothetical protein
NoteTssE
UniProt IDG4LI90
KEGG IDpnc:NCGM2_3378
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|386066307|ref|YP_005981611.1| hypothetical protein NCGM2_3378 [Pseudomonas aeruginosa NCGM2.S1]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPAHARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGRLRSGSRLMPALFVIEQGNDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|386062973|ref|NC_017549.1|:3615815-3616240 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGCATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCACGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGTGGCCGCCTGCGCAGCGGGTC
GCGCCTGATGCCTGCGCTATTCGTCATCGAACAGGGCAACGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA