SecReT6
Protein ID: 386066313
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3384
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3623298..3625304 [+]
Producthypothetical protein
NoteTssI
UniProt IDG4LI96
KEGG IDpnc:NCGM2_3384
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-71, Aligned region: 31..322
Phage_base_V [PF04717], Evalue: 5.10E-23, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|386066313|ref|YP_005981617.1| hypothetical protein NCGM2_3384 [Pseudomonas aeruginosa NCGM2.S1]
MPRPTDSTTSLSLTASALAALFPERLAGEERLNALPGWELLGYSASPLALDGAIATHLTATLHNDADQRP
LDGLVAEIRQLPGDASAERYQVLLRPWLWWLTLASNNRVFQNLATSDIVTQVFDQHGFSDYQLQLSGSYQ
PREYCVQYGESDLAFVSRLLEEDGIFWFFTHAAGKHTLVLADSNDAFPPIPNGPQVAYLGQGIGVRELQG
VRSAQYSLQAVSGTYSATDYEFTTPGTSLYSQAEAVSGAAGVYQHPGGYTAKAQGDSLTKQRIDGLRSQE
TRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRM
HTQTALVVGKAGEEIWTDQYGRIKIQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDFNVN
VLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGG
NYSHKVSGNFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|386062973|ref|NC_017549.1|:3623298-3625304 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGCCCCGTCCCACCGATAGCACTACCAGCCTCTCCCTGACCGCCTCGGCGCTGGCAGCCCTGTTCCCGG
AGCGTCTGGCCGGGGAAGAACGCCTGAACGCACTGCCCGGTTGGGAACTGCTGGGCTACAGCGCCAGCCC
CTTAGCCCTGGACGGCGCAATCGCCACCCATCTCACCGCCACCCTGCACAACGACGCCGACCAGCGTCCG
CTCGACGGCCTGGTCGCGGAGATCCGCCAACTCCCCGGCGATGCCAGCGCCGAGCGCTACCAGGTGCTGT
TGCGCCCCTGGCTCTGGTGGCTGACGCTGGCCAGCAACAACCGGGTGTTCCAGAACCTGGCCACCAGCGA
CATCGTCACCCAGGTCTTCGACCAGCACGGCTTCAGCGACTACCAGTTGCAGCTCAGCGGCAGCTACCAG
CCCCGCGAATACTGCGTGCAGTACGGCGAGAGCGACCTCGCCTTCGTCTCGCGGCTGCTGGAGGAAGACG
GCATCTTCTGGTTCTTCACCCATGCCGCCGGCAAGCACACCCTGGTGCTGGCCGACAGCAACGACGCCTT
CCCGCCGATTCCCAACGGCCCGCAAGTGGCCTACCTGGGCCAAGGAATCGGCGTGCGCGAGTTGCAGGGC
GTGCGTTCGGCGCAGTACAGCCTCCAGGCGGTATCCGGGACCTACAGCGCCACCGACTACGAGTTCACCA
CCCCGGGCACCTCGCTGTACTCCCAGGCCGAGGCGGTTTCCGGCGCCGCCGGCGTCTACCAGCACCCCGG
CGGCTACACCGCCAAGGCCCAGGGCGACAGCCTGACCAAGCAACGCATCGACGGCCTGCGCAGCCAGGAG
ACGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATG
ACGACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCG
CAATCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCCCCGCGCGGGTCACGCCCAAGCCGCGCATG
CACACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGTGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCCTCCTGCTGGGTGCGCGTGGTGCT
GCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGACAATCAGACGCAGTCCGGGATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGACGCCGAGGAAGTCTTCCTCCAGGCGCAGAAGGACTTCAACGTCAAC
GTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAG
CGACAGTCTGGATGTGAAGGACACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACAAGGTCAGCGGCAACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCG
GCACCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCCGG
CACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCC
GGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACG
GCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTAAAGGTCAACTGA