SecReT6
Protein ID: 386078874
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1656
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1818308..1818811 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDG7UCC8
KEGG IDpaq:PAGR_g1656
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-27, Aligned region: 19..143
Protein Sequence: 167 a.a.     [Download]
>gi|386078874|ref|YP_005992399.1| type VI secretion system protein VasD [Pantoea ananatis PA13]
MAQTYFRVGLAKWIWPFLLLLLTACSSSKPDIARYNLHFQAHPSINSGAPLKVRVMLLTSDAEFMSADFF
TLQNQPATALGNTLLNNQQFFLMSGQLSKTLSAKSLPDARFIGIMAEYQKLDGKVWRLALPFPDSDSSSF
WQFWKSNDGELNANIIVDDAGMRPVKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1818308-1818811 Pantoea ananatis PA13 chromosome, complete genome
ATGGCACAAACTTACTTTCGCGTTGGCCTGGCAAAATGGATCTGGCCCTTCCTGCTGCTTCTGCTAACGG
CATGCAGTAGCAGTAAGCCTGATATTGCGCGATACAACCTGCACTTTCAGGCTCATCCTTCCATCAATTC
GGGCGCACCTCTCAAAGTCCGGGTGATGTTGCTGACGTCTGATGCAGAATTTATGTCCGCCGACTTCTTC
ACTCTGCAGAATCAACCCGCTACCGCACTGGGAAATACGCTGCTCAACAATCAGCAGTTTTTCCTGATGT
CCGGTCAGCTCAGTAAAACGCTGAGTGCCAAAAGCCTCCCCGACGCGCGCTTTATCGGCATCATGGCGGA
ATATCAAAAGCTGGATGGCAAGGTGTGGCGACTTGCGCTGCCTTTCCCAGACAGTGACAGCAGCTCGTTC
TGGCAGTTCTGGAAAAGCAATGATGGTGAGTTAAACGCCAACATTATCGTTGACGATGCCGGCATGCGTC
CCGTTAAGCAATAA