SecReT6
Protein ID: 386078875
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1657
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1818833..1820173 [+]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDG7UCC9
KEGG IDpaq:PAGR_g1657
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-150, Aligned region: 19..442
Protein Sequence: 446 a.a.     [Download]
>gi|386078875|ref|YP_005992400.1| type VI secretion system protein ImpJ [Pantoea ananatis PA13]
MNRAEKVVWAEGMFLRPHHFQQAENFLQSSLREWGQSQRPYVWGFFDLEFDEALLRQGKLALSAASGCLP
DGTFFAFSQPQHGPAPLDVPSNTDRAKVVLAIPARRNGREAVTFQDAPDSLARYLAWEAEVEDDNAQAVG
TATVQFGKLRLRLMLEQDLTAEWTAMGVAQIVEKRSDNHIRLDNDYIPPTLTLAGSRPLQSMMTDLHGMI
QQRSQQLSQRAPGTGRFNSADMVDFMLLALLNRQLGLHAHLQHLPLLHPETLYSHWLQLAAELATWTEAR
TPDAFPLYDHDDLQGCFSRLTLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPDNSMVREFGFVLAVKA
NVPADALKTHFPAQMKVAPVTKIRDLVQLQLPGLALKAMPGAPPQIPWHAGYSYFELDKNSELWQEMERS
GAFALHLAGEFPGLNMEFWAIRSQSE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1818833-1820173 Pantoea ananatis PA13 chromosome, complete genome
ATGAACAGAGCCGAAAAGGTTGTTTGGGCGGAAGGGATGTTTTTACGTCCTCACCATTTCCAGCAGGCAG
AAAACTTTCTGCAAAGCTCGCTGCGTGAATGGGGCCAGTCGCAACGCCCTTATGTTTGGGGATTTTTCGA
TCTCGAATTTGATGAAGCGCTGTTGCGGCAGGGTAAACTGGCACTGAGCGCCGCCAGTGGATGCCTGCCG
GATGGAACGTTTTTTGCCTTCAGTCAGCCACAACACGGCCCTGCGCCGCTGGACGTTCCCAGCAATACCG
ACCGCGCCAAAGTGGTTTTGGCCATTCCCGCTCGCCGCAATGGTCGCGAGGCGGTGACGTTTCAGGACGC
GCCTGATTCGCTGGCTCGCTATCTGGCCTGGGAAGCGGAAGTTGAAGATGACAATGCGCAGGCTGTCGGA
ACGGCCACCGTTCAGTTTGGCAAGCTACGCCTCCGCTTGATGCTGGAGCAGGATCTCACGGCGGAATGGA
CGGCGATGGGCGTTGCTCAGATAGTTGAAAAGCGCAGCGACAACCATATCCGTTTAGACAATGATTATAT
CCCTCCCACGTTAACCCTTGCTGGCAGTCGTCCGCTTCAGAGCATGATGACCGACCTGCACGGCATGATT
CAACAACGTAGCCAGCAGCTGAGCCAGCGCGCACCCGGAACGGGCCGCTTTAACAGCGCGGATATGGTTG
ATTTTATGCTGCTGGCGTTGCTTAACCGCCAGTTGGGCCTTCATGCGCATCTGCAGCATCTGCCGCTATT
ACATCCCGAAACCCTCTACAGCCACTGGCTGCAGCTGGCTGCTGAGCTGGCAACGTGGACAGAGGCGCGC
ACGCCGGATGCTTTCCCTCTCTATGACCACGACGACCTGCAGGGTTGCTTCTCCCGCCTGACGCTATTAC
TCCGTCAGGGCCTGTCGCAGGTGATGGAAGAGAGCGCCATTCAGTTGCCGCTGACGCAACGCTCACACGG
CCTGAACGTGGCGACCGTGCCGGATAACAGCATGGTGCGTGAATTCGGTTTTGTGCTGGCCGTAAAAGCA
AACGTCCCGGCCGACGCGCTGAAAACGCATTTTCCGGCGCAGATGAAAGTCGCCCCCGTCACCAAAATTC
GCGATCTCGTCCAACTGCAGCTACCGGGCCTTGCCCTGAAAGCCATGCCGGGTGCGCCACCGCAGATCCC
ATGGCACGCAGGATACAGCTATTTTGAGCTGGATAAGAACAGCGAGCTATGGCAGGAGATGGAGCGATCG
GGTGCCTTCGCGCTGCACCTTGCCGGTGAGTTTCCGGGCCTGAACATGGAGTTCTGGGCCATTCGCAGTC
AGTCAGAATAA