SecReT6
Protein ID: 386078876
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1658
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1820190..1821431 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDG7UCD0
KEGG IDpaq:PAGR_g1658
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-71, Aligned region: 21..226
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|386078876|ref|YP_005992401.1| type VI secretion system protein ImpK [Pantoea ananatis PA13]
MMQEQNKPNSDAFQQDLSHQNSLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRRFELACQQSGLS
YEVIVGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQLLAKLSQNPRQHILLLELI
YFCLLLGFEGRYRVLDNGRSQLDTIKQRLLQMIRSVRGSFAAALSPHPTDQPVLRKLWRPMIPLWACAAL
AGLAACLFYIVLNWRLGDYTSPVLAKIYQTTLPEVQIRNPAPPPPPSLNLKSFLKPEIDEGLVAVRDEAD
QSVVTLKGDGLFASGSTEVRGRYDAVIQRVAEAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQS
VQTLLQKQLAKPSRVKAEGRGETHPLVPNTSAENRARNRRVEITLQVAPDTTQAEVNGLARGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1820190-1821431 Pantoea ananatis PA13 chromosome, complete genome
ATGATGCAGGAACAAAATAAACCGAACAGTGATGCTTTTCAGCAGGATCTTAGCCACCAGAATAGTTTGG
TGGCTGCAGCGAATCCGCTGATTAACGCGATTCCACAGATTCGTCACTCCGTCTCCCATGACGATCCCGC
ACGTTTACGTCAACAGCTTATTGACCAGATCCGCCGTTTCGAGCTGGCCTGCCAGCAGTCCGGACTGAGC
TATGAGGTGATCGTTGGCGCGCGCTATTGTCTGTGTACGGCGCTTGATGAAGCCGCAGCACTGACGCCCT
GGGGAAGCCGTGGCGTGTGGACCAGTAATGGCTTACTGGTCACCTTCCACAACGAAACCTGGGGCGGGGA
GAAATTCTTCCAACTGCTGGCGAAACTGTCGCAAAACCCGCGTCAGCACATCCTGTTACTGGAGCTGATC
TATTTCTGCTTACTGCTTGGTTTTGAAGGGCGCTATCGGGTTCTGGATAATGGACGCTCGCAACTGGATA
CGATTAAACAGCGTCTGTTGCAGATGATCAGGAGCGTCAGGGGCAGCTTTGCCGCCGCCTTGTCGCCGCA
TCCGACCGATCAGCCGGTTCTGCGTAAACTCTGGCGCCCCATGATTCCGCTGTGGGCCTGTGCGGCTCTG
GCGGGCCTGGCTGCCTGCCTGTTCTATATCGTGCTGAACTGGCGTCTGGGGGATTACACCTCGCCCGTGC
TGGCCAAAATCTACCAAACGACGCTGCCAGAAGTGCAGATTCGTAATCCGGCACCGCCGCCGCCGCCGTC
ACTGAACCTGAAGTCATTCCTGAAACCTGAAATCGACGAAGGCCTGGTGGCCGTGCGCGATGAGGCAGAT
CAAAGTGTGGTGACGCTGAAAGGCGATGGCTTGTTCGCATCCGGTTCGACAGAGGTTCGCGGACGTTATG
ATGCCGTTATCCAGCGTGTAGCTGAAGCCATGAATAACGTCAGCGGGAAAATCCTGGTGGTGGGCTACAG
CGATAACGTACCGATTCGCAGTGCCCGATTTGCCTCCAACTATGAGCTGTCTCTGGCCCGTGCCCAGTCT
GTTCAGACGCTGTTACAAAAACAGCTGGCAAAACCATCACGCGTTAAAGCGGAAGGGCGGGGTGAAACGC
ATCCGTTGGTGCCGAATACCAGTGCAGAAAATCGCGCGCGTAATCGTCGTGTTGAAATTACGCTGCAGGT
TGCACCTGATACGACGCAAGCTGAAGTTAACGGCCTGGCGAGAGGGAACTAA