SecReT6
Protein ID: 386078879
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1661
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1825800..1826822 [+]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDG7UCD3
KEGG IDpaq:PAGR_g1661
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 54..113
Protein Sequence: 340 a.a.     [Download]
>gi|386078879|ref|YP_005992404.1| type VI secretion system protein ImpA [Pantoea ananatis PA13]
MSIDIDTLLIPVSHDNPCGENLEYDADFQAMEQASVGKAEQQFGNTIIPAEPADWNKVEKLALELMSRSK
DLRVMLTLTHAWTRLKGLPGYAQGLQLIEQAMLQFWEPLWPRLEEDGEHDPFYRINALAVLGDQSALTAA
VRQSWLMRYASDGITLRDASALCDGSKTEVPDYPGGLPRLNDELARGEQPGIAAIQNIAERLQNIRRIVI
EKLDETALPDMSQLQRSMAMLNERCQATDMESLHSLAAAMQSAPATEQQPSVAAPRAATDWRSAQLNSRA
EAQLMLEKVKQYFSQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQLENIFGRRD
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1825800-1826822 Pantoea ananatis PA13 chromosome, complete genome
ATGAGTATTGATATTGACACGTTGCTGATACCGGTAAGCCACGATAATCCGTGCGGTGAAAACCTGGAGT
ACGACGCGGACTTTCAGGCGATGGAGCAGGCCAGCGTGGGAAAAGCCGAACAGCAGTTCGGTAACACCAT
TATTCCGGCTGAGCCAGCGGACTGGAACAAAGTTGAAAAGCTCGCGCTGGAACTGATGAGCCGCAGCAAA
GACCTGCGTGTCATGCTGACCCTGACACATGCCTGGACGCGCCTGAAAGGGTTACCGGGCTATGCACAGG
GCCTGCAACTGATTGAACAGGCGATGTTGCAGTTCTGGGAACCGCTCTGGCCTCGCCTTGAAGAAGACGG
TGAGCACGACCCGTTTTACCGCATCAACGCGCTGGCTGTGCTGGGCGACCAGTCGGCACTCACGGCCGCC
GTTCGTCAGTCATGGCTCATGCGCTATGCGTCCGACGGTATTACGCTGCGTGATGCTTCGGCGCTGTGTG
ACGGCAGTAAAACAGAGGTACCAGATTATCCGGGTGGACTGCCGCGTCTGAATGACGAACTGGCACGAGG
GGAACAACCGGGCATCGCAGCGATTCAAAACATTGCCGAGCGTTTGCAAAATATTCGCCGCATCGTGATT
GAAAAGCTGGATGAAACGGCCTTGCCGGATATGAGCCAGCTGCAACGCAGCATGGCAATGCTGAATGAGC
GCTGTCAGGCCACGGATATGGAATCGTTACACTCCCTGGCGGCGGCGATGCAATCCGCACCCGCAACTGA
GCAGCAGCCCAGCGTCGCTGCACCACGTGCGGCTACCGACTGGCGCAGTGCCCAACTGAATTCGCGGGCA
GAAGCCCAACTTATGCTGGAAAAAGTCAAACAGTACTTTAGTCAGCATGAGCCGAGCCACCCGGCACCGC
TGATGATTGACCGGGTACAGCGCCTTATCGAACTCGATTTTATGGACATCATTCGCGATCTCGCGCCCGA
TGGTGTGCATCAGTTAGAAAACATTTTTGGACGCCGCGACTAA