SecReT6
Protein ID: 386078880
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1662
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1826903..1827433 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDG7UCD4
KEGG IDpaq:PAGR_g1662
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.70E-61, Aligned region: 12..164
Protein Sequence: 176 a.a.     [Download]
>gi|386078880|ref|YP_005992405.1| type VI secretion system protein ImpB [Pantoea ananatis PA13]
MPTMKSSGQKFIARNRAPRVQIEYDVEVYGAERKIQLPFIMGVLADLAGKPLEPQASVDDRKFMEIDIDN
FDERMKAMKPRAAFQVDNTLNGDGKLNIDLTFESMDDFSPDAIARKVDPLNSLLEARTQLSNLLTYMDGK
NGAEELIGKILQDPTLLQALSHVPKQTDAPEGKEEQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1826903-1827433 Pantoea ananatis PA13 chromosome, complete genome
ATGCCAACAATGAAGTCCAGTGGGCAGAAATTTATCGCCCGCAATCGCGCGCCACGCGTTCAGATTGAAT
ATGACGTGGAAGTCTATGGCGCAGAACGTAAAATTCAGCTGCCATTCATCATGGGTGTTTTGGCCGATTT
AGCCGGTAAACCGCTGGAGCCGCAGGCCAGCGTTGACGACCGTAAATTCATGGAAATCGACATCGACAAT
TTCGATGAGCGTATGAAAGCCATGAAGCCACGTGCGGCATTCCAGGTAGACAATACGTTGAACGGTGACG
GCAAACTGAACATCGATCTGACCTTCGAAAGCATGGACGATTTTTCTCCCGATGCCATTGCCCGCAAAGT
CGATCCACTAAACAGCCTGCTTGAAGCACGTACCCAGCTCTCCAACCTGCTGACCTATATGGACGGCAAA
AACGGCGCCGAAGAGCTGATCGGCAAGATTTTACAGGATCCGACACTGCTGCAGGCGCTGTCACACGTGC
CTAAGCAAACGGATGCCCCTGAAGGTAAGGAGGAGCAGTAA