SecReT6
Protein ID: 386078881
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1663
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1827433..1828932 [+]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDG7UCD5
KEGG IDpaq:PAGR_g1663
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-198, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|386078881|ref|YP_005992406.1| type VI secretion system protein ImpC [Pantoea ananatis PA13]
MNQTSQQPQSQGGASFSQDEFSALLNKEFRPKSDQAREAVESAVKTLAQQALENTVTMSSDAYRTIQALI
AEIDEKLSQQVNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELSRTLKRYKGVGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGSDHSNYSWTN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVEDLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1827433-1828932 Pantoea ananatis PA13 chromosome, complete genome
ATGAACCAGACTTCTCAACAACCACAATCGCAGGGCGGCGCCAGCTTTAGTCAGGATGAGTTCAGCGCGT
TACTGAACAAAGAATTCCGTCCTAAAAGCGACCAGGCACGCGAAGCTGTAGAAAGCGCGGTGAAAACGCT
GGCGCAGCAGGCGCTGGAAAACACCGTGACCATGTCCAGCGATGCCTACCGCACCATTCAGGCACTGATC
GCTGAGATTGACGAAAAGCTGTCTCAGCAGGTTAACCAGATTATTCATCACGAAGAGTTTCAGAAGCTGG
AAAGCGCCTGGCGTGGTCTGAGCTATCTGGTGAATAACACCGAAACTGATGAGATGCTCAAGATTCGCTT
TATGAGCATCTCCAAGCAGGAGCTGAGCCGCACCCTGAAACGCTATAAAGGCGTGGGCTGGGATCAGAGC
CCGCTGTTCAAGAAAATCTACGAACAGGAATATGGCCAGTTTGGTGGTGAACCTTTTGGCTGCCTGGTGG
GCGACTACTATTTCGATCACAGCCCGCAGGACGTCGAGCTGCTGGGCGAAATGGCGCGTATCGGTGCTGC
AGCACACTGTCCGTTTATCACCGGGACAGCCCCAAGCGTAATGCAGATGGAATCCTGGCAGGAACTGGCG
AATCCACGCGATCTGACCAAAATCTTCCAGAATACCGAATATGCTGCCTGGCGCAGCCTGCGCGAGTCTG
AAGACGCGCGCTATCTGGGCCTGGTGATGCCGCGCTTCCTTTCTCGTCTGCCTTACGGTATTCGCACCAA
CCCCGTGGACAGCTTTGATTTTGAAGAGCAGACCGACGGTTCCGACCACAGCAACTACAGCTGGACCAAC
GCGGCTTATGCCATGGCGGCCAACATCAACCGTTCGTTCAAAGAATACGGCTGGTGTACATCCATTCGCG
GCGTGGAGTCGGGTGGGGCGGTTGAAGATCTGCCTTGCCACACGTTCCCAAGCGATGACGGCGGCGTAGA
CATGAAATGCCCAACGGAAATCGCCATCAGCGATCGCCGCGAAGCCGAGCTCGCGAAGAATGGCTTTATG
CCGTTAGTTCACCGCAAAAACTCTGACTTTGCCGCCTTTATCGGCGCCCAGTCGCTGCAAAAGCCTGCGG
AGTACCACGATGCTGACGCCACCGCCAATGCGCGTCTGGCAGCGCGGCTGCCTTATCTGTTCGCCTGCTG
CCGTTTCGCTCACTATCTGAAGTGTATTGTGCGCGACAAGATTGGTTCCTTCCGCGAGCGCGACGAAATG
GAACGCTGGTTGAACGACTGGGTGATGAACTATGTCGATGGTGACCCGGCTAACTCTTCTCAGGAAACCA
AGTCTCGTAAGCCGCTGGCTGCTGCAGAGGTGAATGTGGAAGAGCAGGAAGACAATCCAGGTTATTACGC
CGCGAAATTCTTCCTGCGTCCGCATTACCAGTTGGAAGGGTTAACCGTTTCGCTGCGTCTGGTATCGAAA
CTGCCTTCGCTGAAGTCGAACGAAAACTAA