SecReT6
Protein ID: 386078885
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1667
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1832272..1834167 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDG7UCD9
KEGG IDpaq:PAGR_g1667
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-07, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0012, Aligned region: 32..49
UreE_N [PF02814], Evalue: 0.0012, Aligned region: 78..99
Protein Sequence: 631 a.a.     [Download]
>gi|386078885|ref|YP_005992410.1| FHA domain-containing protein [Pantoea ananatis PA13]
MRFTIITAKPGHEPPQISFDFLPPGGTIGRGVDNNLILPDDDRTISRLQAIVHITAEGECRLTNRGNVTR
VLLNDIPLERGRQVELQDGDILGIDDYRLLVNDLNGEQQSQQPPLTAAAAPKQQPVPNAVPVQAPAASTA
AIPSEIWDSLAKEFSISDDLSKRKSAAQEMPEANPLTSTAANRNPEDPLAQLMSDKPLDIGQQPKTSSLF
DEEDALFAQESIFDDRTPSTLSAKQNAQGQPKIEETSTDVDPLNLFGSQTTPDPRHHDDPLGLMMSGAVP
LAQPDMPVSQPVAAPSQPKENHQSAPLQQKEPHQAAPLQQKPHHQPMPDILDTAPVELADLSSSPLFDHT
ETQVTHDPAFDPQPQPAQPEGAQSPIDYGGITLPTPQAVQRTPSPTPKGRLRIDPVASHNNSGGTEQSGN
ASSGDALKGELLDALLEGMGLQDLQPTPQFDREQMRQFGQMLSMFSQGTVALLSSRSILKRGVKADMTVI
LDDANNPFKLLPSGKTVLMQMFGSRMPGFMPPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPDQL
EEEARQNGSVSRIGLPGSRKAALWEHFIQRYGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQTHTDD
A
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1832272-1834167 Pantoea ananatis PA13 chromosome, complete genome
ATGCGCTTTACGATAATAACCGCTAAACCCGGCCATGAACCGCCGCAAATCAGTTTCGATTTTCTTCCTC
CAGGCGGCACTATTGGTCGAGGCGTGGATAATAATCTGATATTGCCCGACGACGATCGCACTATTTCTCG
CCTGCAGGCTATCGTGCATATTACTGCAGAGGGTGAATGTCGCCTGACCAACCGCGGTAACGTTACGCGC
GTGCTGCTGAATGACATCCCGCTTGAACGTGGACGTCAGGTGGAGTTGCAGGACGGAGATATTCTCGGCA
TCGACGACTATCGTCTGCTGGTTAACGATCTTAATGGCGAGCAGCAATCGCAGCAGCCTCCGTTGACCGC
TGCAGCCGCACCTAAGCAGCAGCCCGTACCCAATGCGGTCCCTGTACAGGCGCCGGCTGCCAGCACGGCT
GCCATTCCCAGCGAGATCTGGGACAGCCTTGCCAAAGAGTTTTCAATTTCTGATGATTTATCGAAACGTA
AAAGTGCTGCGCAAGAAATGCCGGAGGCAAATCCGTTAACCTCTACAGCAGCAAACCGTAATCCCGAAGA
TCCGCTGGCTCAGTTAATGAGCGATAAACCGCTGGATATCGGTCAGCAACCTAAGACAAGCAGCCTGTTT
GATGAAGAGGATGCACTGTTTGCTCAGGAAAGCATTTTTGATGACCGCACGCCCAGCACCTTGTCGGCAA
AACAAAATGCGCAAGGGCAGCCCAAAATAGAGGAAACCTCCACAGACGTGGACCCGTTAAATCTGTTTGG
CAGCCAGACCACGCCGGACCCGCGTCATCATGACGATCCGCTGGGGTTAATGATGAGCGGTGCCGTGCCG
CTGGCTCAGCCAGATATGCCGGTTTCGCAACCTGTGGCTGCGCCATCGCAGCCGAAAGAAAACCATCAGT
CTGCACCCTTGCAGCAGAAAGAGCCCCATCAAGCGGCGCCATTACAGCAGAAACCTCATCACCAGCCGAT
GCCTGATATCCTGGATACTGCACCGGTTGAGTTGGCTGATTTAAGCAGTTCACCGCTGTTTGATCACACT
GAAACGCAGGTCACTCACGATCCCGCTTTCGATCCTCAACCGCAGCCTGCCCAGCCTGAAGGAGCGCAAA
GCCCGATTGATTACGGCGGCATTACCTTGCCAACACCGCAGGCGGTGCAACGCACGCCTTCGCCCACGCC
AAAAGGGCGGCTGCGCATCGATCCGGTTGCCTCGCACAATAACAGCGGTGGGACCGAGCAGAGTGGCAAT
GCCAGTAGCGGTGATGCCTTAAAGGGCGAGTTGCTGGATGCACTGCTGGAAGGTATGGGCCTGCAGGATC
TGCAACCGACACCGCAGTTCGATCGTGAGCAGATGCGGCAGTTCGGCCAGATGCTCAGCATGTTCTCGCA
GGGAACGGTGGCACTGCTGTCTTCCCGGTCGATTTTAAAACGCGGTGTAAAAGCCGACATGACCGTGATC
CTGGATGATGCTAACAACCCGTTTAAGCTGCTGCCGTCAGGTAAAACCGTATTGATGCAGATGTTTGGCA
GCCGTATGCCAGGTTTTATGCCGCCACGCCAGGCCGTGCGTGACGCACTGATTGACCTCCAGGCGCACCA
GTTAGGGATGATTGCCGGTATTCGCGCCATTATTGCTTCCATGCTGCAGTCCTTTAACCCCGATCAGCTC
GAAGAAGAAGCGCGTCAAAACGGTTCCGTATCGCGCATTGGACTACCCGGCAGCCGTAAAGCCGCGCTGT
GGGAGCATTTTATCCAGCGCTATGGCGAAACTGCCGGTGAAATTGAAGATGACTTCCATACCTTGTTTGG
CGAAGCCTTCTTGCACGCGTACGACATGGAAGTAAATCAGTATAAAGACTCACAAACCCACACGGATGAC
GCATGA