SecReT6
Protein ID: 386078888
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1670
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1835981..1836808 [+]
Productputative type VI secretion system-associated protein
NoteTagJ
UniProt IDG7UCE2
KEGG IDpaq:PAGR_g1670
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-41, Aligned region: 144..265
Protein Sequence: 275 a.a.     [Download]
>gi|386078888|ref|YP_005992413.1| putative type VI secretion system-associated protein [Pantoea ananatis PA13]
MDSLQQRLANATLAENLSSITAQIQANPADADLRAAFVQLLCLDGNWSRAQTQLKSWLAMLPQAQPTVTL
LQQAIEGEQKRAAVLRGEAEPQLPGSAWPWCQVLLAALKADIAGDKAVGAALRAQALESAEASAGTATTQ
EGESPFAWIMDGDSRFGPVCEAIANGHYYWIPFAAISEIEFQAPASVTDLVWRHTRLQLVDGSEQICQIP
VRYPLQDKADERFLRASVTEWQESGSDDGQFIGHGQKMWLSDEADYPLLTLQQLIFNETELPHES
 
Nucleotide Sequence: 828 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1835981-1836808 Pantoea ananatis PA13 chromosome, complete genome
ATGGACTCACTACAACAGCGACTGGCCAATGCCACCCTGGCGGAAAACCTGTCCAGCATCACTGCACAAA
TCCAGGCGAATCCGGCTGATGCGGATTTACGGGCGGCATTTGTGCAACTCCTGTGCCTTGACGGTAACTG
GAGCAGGGCGCAGACACAGCTGAAATCCTGGCTGGCCATGCTGCCTCAGGCGCAGCCCACCGTGACCTTG
CTGCAACAGGCCATTGAGGGCGAACAGAAACGTGCAGCGGTTTTGCGCGGTGAAGCCGAGCCGCAACTGC
CAGGAAGCGCCTGGCCGTGGTGCCAGGTCTTACTGGCCGCGCTGAAAGCGGACATAGCGGGCGATAAGGC
CGTCGGTGCGGCACTGCGTGCTCAGGCGCTGGAAAGCGCAGAGGCGAGCGCCGGTACGGCCACAACCCAG
GAGGGGGAAAGCCCGTTCGCCTGGATAATGGACGGTGACAGCCGCTTCGGACCGGTCTGTGAAGCCATCG
CCAATGGACACTATTACTGGATCCCGTTTGCTGCCATCAGCGAAATAGAGTTTCAGGCTCCGGCAAGCGT
CACGGATCTGGTCTGGCGCCATACTCGCCTGCAGCTGGTGGACGGAAGTGAGCAAATTTGTCAGATTCCG
GTGCGCTACCCGCTTCAGGACAAGGCTGATGAACGCTTCCTGCGGGCAAGCGTAACGGAGTGGCAGGAAT
CAGGCAGCGATGACGGTCAGTTTATCGGTCACGGGCAAAAGATGTGGCTCAGCGATGAAGCAGATTATCC
CTTACTGACGCTGCAGCAGCTTATTTTCAACGAAACTGAGTTACCTCATGAGTCGTAA