SecReT6
Protein ID: 386078889
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1671
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1836798..1837373 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG7UCE3
KEGG IDpaq:PAGR_g1671
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-19, Aligned region: 60..170
Protein Sequence: 191 a.a.     [Download]
>gi|386078889|ref|YP_005992414.1| type VI secretion system lysozyme-like protein [Pantoea ananatis PA13]
MSRNDNSSGDGYSQLHGGYRARKNRDTLTARDKLQSSLLDRLTDDAPDKTTESGNSSIITHSTLRRNVLR
DLQWLFNTINNEAQHDLSDLTEVQRSVLNFGVAPLAGQNISDIEWQDMQRKMTDAILHFEPRILPQGLQV
RCVSDLTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQVDLESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1836798-1837373 Pantoea ananatis PA13 chromosome, complete genome
ATGAGTCGTAATGACAATTCGTCCGGTGACGGCTATTCGCAGCTGCATGGCGGCTATCGTGCGCGCAAAA
ATCGCGACACGCTGACGGCGCGTGACAAACTGCAGTCGTCCCTGCTGGACAGGCTGACAGACGACGCGCC
AGATAAAACCACCGAGTCAGGCAACAGTTCGATTATTACCCACAGTACGCTGCGACGTAATGTTCTGCGC
GATCTCCAGTGGTTATTCAACACCATCAATAACGAGGCGCAGCACGATCTGAGCGACCTGACGGAGGTCC
AGCGTTCCGTGCTGAATTTTGGCGTGGCCCCCCTGGCCGGACAGAATATCTCGGACATCGAATGGCAGGA
TATGCAACGGAAAATGACCGATGCCATTCTGCACTTTGAGCCACGCATTTTACCCCAGGGCTTACAGGTT
CGCTGCGTAAGCGACCTGACCTCTCTGAGTCTGCACAACGTACTATCGATTGAGATTAAAGGCCGGTTAT
GGTGCGTGCCGTACCCGCTGGAGTTTCTGTTCCGCACTCAGGTTGATTTAGAGAGCGGCCATTTTGAACT
ACAGGATGCAGGTTAA