SecReT6
Protein ID: 386078890
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1672
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1837376..1839253 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDG7UCE4
KEGG IDpaq:PAGR_g1672
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-211, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|386078890|ref|YP_005992415.1| type VI secretion system protein ImpG [Pantoea ananatis PA13]
MDSKLLDYYNRELAYLREMGAEFAAQYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRMLEMVAPGYLSPTPSMAIAQLTPDSRKGDISNGFLVPRGTMMESQNLKKTGVTCSYTTAHDVMLQP
LRISDVSLGGVPADIPLGELKAGGSTAASSALRIRITCEGISSLSQLSLDDVMFFLSGPDIQALKLMELL
MQHRVGIILQSVEAKPQRQVLPDDALQQEGFSTEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLA
PFLQRCDNALSFDIVILLDKADAALESVVDSAHLALHCTPVINLFPKTAERLKVSDSQHEYHLVVDNIRP
LDYEIHSVKRLFASVEGQREEQIFRPFWSTFSHDGGDYGAYFSLRREQRTLSEHALRYGTRTGYIGSEVF
LSLVDQNHTPWNSDIRYLSAEVMCTSRDLPLMLLQQEQANFVMPDSIPVGQLKLCKGPTPPRPALAEGLS
AWRLISHLQMNYLSLMDSSDGEGAAALRQMLSLYASLAETPLTRQIDGIRHCNLKAVHRRVPEPGPVVFA
RGVSIALEVDEQAFSGASPWLFGSVLERVFSRLVALNSFTEFTLSSQQRGEVGYWPPRMGKKALL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1837376-1839253 Pantoea ananatis PA13 chromosome, complete genome
ATGGACAGCAAGCTGCTTGATTACTACAACCGTGAACTGGCCTATCTGCGCGAGATGGGCGCGGAGTTTG
CTGCCCAGTATCCCAAGGTCGCCGGGCGGCTTGGTATGCGCGGCATTGACGTCGCCGATCCTTATGTCGA
AAGACTTATGGAGGGTTTCGCGTTTCTGACGTCACGCGTGCAGTTAAAGATGGATGCCGAGTTTCCACGC
TTTTCTCAGCGGATGCTGGAAATGGTGGCACCGGGCTACCTTTCACCTACGCCGTCGATGGCCATCGCCC
AGCTCACGCCGGACAGCCGCAAAGGCGATATCAGCAACGGTTTCTTAGTGCCGCGCGGCACAATGATGGA
AAGCCAGAACCTGAAAAAAACGGGCGTCACCTGCAGCTATACCACCGCGCACGATGTGATGTTACAGCCC
CTGCGTATCAGCGATGTGTCGTTAGGTGGCGTGCCAGCGGATATCCCGTTAGGCGAGTTGAAAGCGGGCG
GCTCGACGGCGGCGTCCAGCGCCCTCCGTATCCGCATCACCTGCGAAGGCATTTCATCGTTAAGCCAGCT
CAGTCTCGATGACGTGATGTTTTTCCTGAGCGGACCCGATATCCAGGCCCTGAAACTGATGGAGCTGCTG
ATGCAGCATCGTGTCGGAATCATCCTGCAGTCCGTGGAAGCAAAACCGCAACGTCAGGTTCTGCCGGATG
ACGCGCTTCAACAGGAAGGCTTTTCGACCGAGCAGGCCCTGTTGCCCGACGATCTGCGTAATTTTGACGG
CTACCGCCTGCTGCAGGAGTATTTTGCATTCCCGGCACGCTTCCAGTTTATCAGCCTGCGTCAGCTGGCG
CCTTTCCTGCAGCGCTGCGATAACGCCCTGTCGTTTGACATCGTCATCCTGCTGGATAAGGCCGATGCGG
CGCTGGAAAGCGTTGTCGACAGCGCCCATCTGGCCCTGCACTGCACGCCGGTCATTAACCTGTTCCCGAA
AACCGCCGAGCGGCTTAAGGTCAGCGACAGTCAGCACGAGTATCACTTGGTGGTCGATAACATCCGTCCG
CTGGACTATGAGATCCATTCGGTGAAGCGCTTGTTTGCCTCTGTCGAAGGGCAGCGCGAAGAGCAGATCT
TCCGGCCGTTCTGGAGCACCTTCAGCCATGACGGCGGGGATTATGGCGCGTATTTCTCCCTGCGTCGTGA
ACAGCGCACGCTCTCTGAGCACGCGTTGCGCTATGGCACCCGAACAGGCTATATCGGTTCTGAAGTGTTT
CTCTCCCTGGTGGATCAAAATCATACACCGTGGAACAGCGATATCCGCTATTTGTCTGCGGAAGTGATGT
GTACCAGCCGTGACCTGCCTTTGATGCTGCTACAGCAAGAGCAGGCCAACTTTGTAATGCCGGATTCCAT
TCCTGTCGGGCAACTTAAATTGTGCAAAGGCCCGACGCCACCGCGTCCGGCGCTGGCTGAAGGGCTTTCA
GCATGGCGACTCATCAGTCATCTGCAGATGAACTATCTAAGCCTGATGGACAGCAGCGATGGCGAAGGGG
CTGCGGCACTGCGCCAGATGCTGAGCCTGTATGCCAGCCTGGCCGAAACGCCGCTAACGCGTCAGATTGA
CGGAATTCGGCACTGCAACCTCAAAGCCGTTCACCGCCGGGTGCCCGAGCCGGGCCCCGTGGTGTTTGCG
CGCGGGGTCAGCATTGCGCTTGAGGTGGATGAGCAGGCGTTTTCAGGTGCCAGCCCCTGGCTGTTCGGCA
GCGTGCTGGAGCGGGTCTTTTCTCGCCTCGTGGCGCTTAACAGCTTTACCGAATTCACCCTGAGCAGCCA
GCAGCGCGGCGAAGTGGGCTACTGGCCGCCGCGCATGGGCAAAAAGGCGCTGCTATGA