SecReT6
Protein ID: 386078891
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1673
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1839250..1840299 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDG7UCE5
KEGG IDpaq:PAGR_g1673
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-106, Aligned region: 26..330
Protein Sequence: 349 a.a.     [Download]
>gi|386078891|ref|YP_005992416.1| type VI secretion system protein ImpH [Pantoea ananatis PA13]
MSETAHVIPLQRAVRLPDGFWQAVMAAPWRYDLFQLLRKLDAQSGQRYALGKAPLPKFEAVRIGQKPSLA
FAPSTVSQVKAREQDERYDVSIYSFGLFGPNGPLPTHLTEYVRGRIDHHQDHSLSAFADLFHHRATLLFY
RAWANSQPTSSLDRRDDRRFQDYLACVAGIGLPAQQKASSLSLHARLMLSGHLSRHGHDAEGLVRILRHY
FAVPVKLQQNVPQWLSLDSRDQARLSAGRHMPRLGESAFLGVAVRDVQHRFRLRIGPLSAEQYERFLPNA
QGACEVRDWVRHYLGIEMQWDLSLILAADAVKGLTLGGQARLGYTSWLGQQPQPVDREDFAFEVEATPS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1839250-1840299 Pantoea ananatis PA13 chromosome, complete genome
ATGAGTGAGACGGCGCACGTTATTCCCCTACAGCGGGCGGTGCGTCTGCCTGACGGTTTCTGGCAGGCCG
TGATGGCCGCGCCCTGGCGCTATGATCTGTTTCAGTTGTTACGCAAGCTGGACGCCCAGAGTGGGCAGCG
TTATGCCTTAGGTAAAGCGCCACTGCCCAAATTTGAAGCCGTGCGTATTGGGCAAAAGCCATCCCTGGCC
TTTGCACCATCGACCGTGTCACAGGTTAAAGCGCGTGAGCAGGACGAACGCTACGACGTCTCCATTTACA
GCTTTGGGCTGTTTGGTCCCAACGGTCCTCTCCCTACGCACCTGACGGAATATGTACGCGGACGTATCGA
TCACCATCAGGATCACAGCCTGAGCGCTTTCGCCGATCTGTTTCATCATCGTGCCACGCTGCTGTTCTAC
CGTGCCTGGGCTAATTCACAGCCAACCAGCTCCCTGGATCGCCGCGACGATCGGCGGTTTCAGGATTATC
TGGCCTGCGTGGCCGGTATTGGGTTACCGGCCCAGCAGAAAGCCAGTTCGCTGAGTCTGCATGCGCGCCT
CATGCTGTCAGGGCATCTCAGCCGCCACGGTCACGATGCCGAAGGGCTGGTACGCATTTTGCGTCACTAC
TTTGCCGTTCCGGTTAAGCTGCAACAGAACGTGCCGCAGTGGTTATCCCTGGACAGCCGCGATCAGGCCC
GTCTGTCGGCCGGTCGCCATATGCCGCGCCTGGGTGAATCGGCCTTTCTCGGTGTGGCCGTTCGTGATGT
ACAGCATCGTTTTCGTCTGCGCATCGGTCCACTGAGCGCCGAGCAGTACGAACGTTTTTTACCCAACGCG
CAGGGCGCTTGCGAAGTGCGTGACTGGGTGCGCCACTATCTGGGTATTGAGATGCAGTGGGATCTCAGCC
TGATTCTGGCAGCCGATGCCGTTAAGGGCTTAACCCTTGGCGGTCAGGCGCGGCTGGGCTACACCAGTTG
GCTTGGACAGCAACCGCAGCCTGTCGATCGTGAAGATTTTGCCTTTGAGGTTGAAGCTACGCCGTCATAG