SecReT6
Protein ID: 386078894
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1676
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1844467..1846710 [+]
Productputative type VI secretion system effector protein VgrG
NoteTssI
UniProt IDG7UCE8
KEGG IDpaq:PAGR_g1676
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-74, Aligned region: 23..330
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 368..461
Protein Sequence: 747 a.a.     [Download]
>gi|386078894|ref|YP_005992419.1| putative type VI secretion system effector protein VgrG [Pantoea ananatis PA13]
MFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDGLLSAVNPRYI
NGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAGSY
RVWEYCVQYQESSFDFISRLMELEGIYYFFRHEADKHTLVLCDAPDQHQAFPGYETIAYHVTPSGGSVTE
EGVSQWALSESVTPGMYSTDDYDFRKPNAWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQE
VWQVEHHMVSGSGTATGIAPGYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTVLP
AAVTYRAKPETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWDLPGDATRMGFMTRSKDGHQANASYLFFED
KPGGELLNMHAEKDMNISVENDKTVAIDGSRTTTIGKEQNDEVTGDATFHYKQKRTITVDQLESKNFNNG
ESVKVKNGRKTIISSGGSHSEVTGDKFLKLDGHFSRKISGNDEEHIKGSRAATIDNGDTLTITNGGLNVN
VNGLWHQSATAGVKIESPQDITIKSSTKVFIDSPVFERNDVQKNSFAQDAMDFISKYVSFSVGSVAFKGV
NYGMTGVNISHQGFAFGRTIINAQRVEAARVDSGSLRTALFALHMIM
 
Nucleotide Sequence: 2244 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1844467-1846710 Pantoea ananatis PA13 chromosome, complete genome
ATGTTCTCACGTATTACTGTACAACTTCCCGCACAAGGACTGCTGTTCCGACGTCTGAGCGGCAGCGAAG
CGCTGTCCCAGTCGTTCGTGCTGCAAGCGGAGCTGCTCTCCACCGACGCGCGCATTGATCGTAAGTCGTT
GCTGGGCAAGCCGGTCACTTTCACGCTGCCGACGGATGGTCTGCTGAGCGCGGTGAATCCGCGCTACATC
AACGGCAAAATTACTCAGATAGGCGTGCGCAGCGAGGAGCTGGGCGGCGTGCGCTACGCCGTTTACGGGC
TGACGGTGGAGTCGGATCTGTGGCCGATGAAGCGCGACCGCAACCTGCGCATCTTCCAGAGCCAGACGGT
GCCGCAGATTGTGCAGACGCTGCTGAAGGAGTACGGAGTGAACGTGGAAACGCGCCTGGCGGGCAGTTAC
CGGGTGTGGGAATACTGCGTGCAGTATCAGGAGAGCAGCTTCGACTTTATCAGCCGGCTGATGGAGCTGG
AGGGGATTTACTACTTCTTCCGTCACGAGGCGGACAAGCACACGCTGGTGCTGTGTGACGCGCCGGACCA
GCACCAGGCGTTCCCGGGCTACGAAACCATAGCCTACCACGTGACGCCGTCGGGCGGCAGCGTGACGGAA
GAGGGCGTGAGCCAGTGGGCGCTGTCGGAAAGCGTGACGCCGGGGATGTACAGCACGGACGACTACGACT
TCCGCAAGCCGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGTGTCGCCGACCCCGGGCTCGGTGGA
CGTGTACGACTGGCCGGGTCGCTTCGTGGAGCACGGTCACGGCGAATACTACGCGCGTATCCGCCAGGAG
GTGTGGCAGGTGGAGCACCACATGGTGAGTGGGAGCGGCACGGCGACGGGCATCGCGCCGGGCTACACTT
TTTCGCTGCTGAACGCGCCGCACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTACGACTT
TGAAGAGAACAGCTACGCGAGCGGCGACGTGGGCGCCACGCGGCACAACATCGACTTCACGGTGCTGCCG
GCGGCGGTGACGTACCGTGCGAAGCCGGAGACGCCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGG
TGGTGGGGCCGAAAGGCGAGAGCATCTGGACGGACAAATACGGCCGGGTGAAGGTGAAGTTCCACTGGGA
CCGTCTGGCGAAGGGTGACGACACGAGTTCGTGCTGGGTGCGCGTATCGAGTGCCTGGGCGGGTCAGGGC
TTCGGCGGGGTGCAGATCCCGCGCGTGGGCGATGAAGTCGTCGTCGATTTTATCAACGGCGATCCAGACC
GGCCAATTATTACTGGCCGTGTCTACAACGAAGCCAGCATGCCACCCTGGGATCTCCCCGGCGATGCTAC
ACGAATGGGCTTTATGACACGGAGTAAAGACGGACATCAGGCCAATGCCAGCTATCTGTTCTTTGAAGAT
AAGCCGGGCGGTGAACTGCTGAATATGCATGCTGAGAAAGACATGAATATTTCGGTGGAGAATGATAAGA
CCGTTGCCATTGATGGATCCCGGACCACCACTATTGGCAAAGAGCAGAATGACGAAGTAACAGGTGATGC
GACTTTTCATTACAAACAAAAGCGGACGATAACAGTTGACCAGCTCGAGTCAAAAAATTTTAATAACGGT
GAAAGTGTTAAAGTAAAAAATGGTCGCAAAACCATCATTTCTAGTGGTGGGAGCCACAGTGAAGTAACAG
GTGATAAGTTTTTAAAACTCGACGGCCATTTTTCCAGAAAAATAAGTGGCAACGATGAAGAACACATTAA
AGGTAGCAGAGCGGCCACTATAGATAACGGTGATACACTAACCATTACAAATGGAGGACTTAATGTTAAC
GTAAATGGCTTATGGCATCAGAGTGCAACCGCAGGTGTGAAAATTGAATCGCCGCAAGATATTACTATAA
AAAGTAGTACTAAAGTTTTTATTGATTCACCTGTTTTTGAAAGAAACGATGTCCAAAAAAATAGCTTTGC
ACAAGATGCAATGGATTTTATTAGTAAGTATGTTTCATTTTCGGTAGGAAGTGTGGCTTTCAAAGGTGTC
AACTATGGCATGACAGGTGTGAATATATCACATCAAGGGTTTGCTTTCGGTCGGACCATCATTAATGCTC
AAAGAGTTGAAGCCGCTCGTGTTGACAGTGGAAGCCTGAGGACAGCATTGTTTGCTCTCCACATGATTAT
GTAA