SecReT6
Protein ID: 386309002
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15591
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1558616..1559095 [-]
Productprotein ImpF
NoteTssE
UniProt IDE7B4N4
KEGG IDyey:Y11_15591
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-17, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|386309002|ref|YP_006005058.1| protein ImpF [Yersinia enterocolitica subsp. palearctica Y11]
MEKKRQFLPTLLERLLDDEPKKLLEPHDKFFYDSRTMRKLVQRNIAEILNNANIDDRLDEQRHKWVAKSV
LNYGISPLVGRHSTPHNWTTIERIIREAIIRFEPRILADSLVVNQQHNARNGIIQFEIRGLIEWDPYPID
LCIGGAYDVETDQAELSAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1559095-1558616 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGGAAAAGAAGAGACAGTTTTTGCCTACTCTGCTTGAGCGTTTACTTGATGATGAGCCTAAAAAATTGT
TAGAGCCTCATGATAAGTTTTTTTATGACTCACGTACGATGCGAAAACTGGTGCAGCGGAATATCGCTGA
AATATTAAATAATGCCAATATTGACGACCGGCTTGATGAACAGCGCCATAAGTGGGTGGCGAAGTCGGTT
TTAAATTACGGTATTTCGCCACTGGTGGGGAGGCATTCAACTCCCCATAACTGGACGACTATCGAGCGAA
TTATCCGTGAAGCAATCATCCGTTTTGAACCCCGGATCCTCGCAGATTCTCTGGTTGTCAATCAGCAGCA
TAATGCCAGAAATGGCATTATTCAGTTTGAAATCAGAGGTCTGATTGAGTGGGATCCGTATCCTATTGAT
TTGTGTATCGGCGGGGCCTATGACGTTGAAACCGATCAGGCAGAACTCAGCGCGCGTTAG