SecReT6
Protein ID: 386309003
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15601
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1559095..1559922 [-]
Productprotein of avirulence locus ImpE
NoteTagJ
UniProt IDE7B4N3
KEGG IDyey:Y11_15601
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.00E-45, Aligned region: 144..263
TPR_11 [PF13414], Evalue: 0.0017, Aligned region: 43..76
TPR_11 [PF13414], Evalue: 0.0017, Aligned region: 106..137
TPR_14 [PF13428], Evalue: 0.0093, Aligned region: 35..65
TPR_14 [PF13428], Evalue: 0.0093, Aligned region: 104..137
Protein Sequence: 275 a.a.     [Download]
>gi|386309003|ref|YP_006005059.1| protein of avirulence locus ImpE [Yersinia enterocolitica subsp. palearctica Y11]
MNTTNLNELLKSSSLAEIQSDVIATLKAKPADTNARELLFKLYCLAGSWQKALLQIETLTKFAPDMTKQA
ELYKNLVLSETLREEVLAGKRDPGTLGNPLPEWAILMQQANQHLHEGDYSQSEELREQALSQAPESAGEN
SSATPFSWIADSDSRIGPVCEFISAGGYRWVPFADVQLMTISKPKNITDLVWAPAQLTVNNKVWYGYIPA
RYPLSLNADNDTKLGLKTEWSQPADSLYIGSGRKMFITDQNEYALFDIEEFRFDVEKFGFDEQAN
 
Nucleotide Sequence: 828 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1559922-1559095 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGAATACGACCAACTTAAATGAATTATTGAAAAGCAGCTCATTGGCCGAAATACAATCGGATGTTATTG
CCACGTTGAAAGCCAAGCCGGCAGATACCAATGCACGCGAGCTATTATTTAAGCTCTATTGTTTGGCTGG
GTCATGGCAAAAAGCGTTATTGCAAATTGAAACACTGACTAAATTTGCCCCAGATATGACTAAGCAGGCA
GAGCTTTATAAGAATCTGGTCTTGAGTGAGACGTTGCGTGAAGAAGTGTTAGCAGGGAAACGCGATCCTG
GAACCTTAGGTAACCCCCTGCCTGAGTGGGCGATATTGATGCAGCAAGCTAACCAACATTTGCATGAGGG
TGATTACTCACAAAGCGAAGAACTGCGTGAGCAAGCATTGTCACAAGCCCCCGAAAGTGCTGGGGAAAAT
AGCTCAGCGACGCCCTTTTCATGGATAGCGGATAGTGATAGTCGCATCGGGCCGGTTTGTGAGTTTATCA
GCGCAGGCGGTTATCGGTGGGTACCTTTCGCTGATGTTCAATTAATGACGATTTCTAAGCCTAAAAATAT
TACAGACTTGGTATGGGCACCGGCACAATTGACGGTAAATAATAAAGTTTGGTACGGCTATATCCCGGCA
CGTTATCCGTTATCTCTCAATGCTGATAATGACACTAAACTTGGCCTTAAAACTGAATGGAGCCAACCGG
CAGACTCACTCTATATTGGTTCAGGGCGGAAAATGTTTATTACCGACCAAAATGAGTACGCATTATTCGA
TATTGAAGAGTTTAGATTTGATGTTGAAAAGTTTGGATTTGACGAACAGGCTAATTAA