SecReT6
Protein ID: 386309006
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15631
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1561168..1563912 [-]
Producthypothetical protein
NoteTssI
UniProt IDE7B4N0
KEGG IDyey:Y11_15631
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-76, Aligned region: 23..342
Phage_base_V [PF04717], Evalue: 1.20E-24, Aligned region: 380..473
Gp5_C [PF06715], Evalue: 0.00024, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 0.00024, Aligned region: 531..553
Gp5_C [PF06715], Evalue: 0.00024, Aligned region: 592..599
Protein Sequence: 914 a.a.     [Download]
>gi|386309006|ref|YP_006005062.1| hypothetical protein [Yersinia enterocolitica subsp. palearctica Y11]
MSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPSIPWQTASNVDLKALIGKEMTIEMELDG
NGLDYVKGVGKGTREISGLVEKARFIGRDANQAMFEIVLRPWFYLTDLTSDFKIFQNKNVVDIIDEVLAD
YNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHDDHKQKLILVDHVGAHKRYFSEAYH
TIEYLSDEPKAGEEYITQFQTQETLTTGRWVYNDYDFTKSRADILTMDSKPRKTSFSDLEIYQWPGDYDQ
PDIGEHLARVRIEERGALGSRAVGCGEVRGIVCGANFELQGFPVDKANREYMVISSRLSVSEVAQLSRGD
EFHYETTFTVQPTTKIYRHPQLTPKPKTSGPQNAIVVGPPGEEVWTDEYGRVKVRFVWDRYGKNAESDSC
WLRVSQAWAGNSFGGIYIPRIGQEVLVDCINGDPDRPLVSGSLYNNVTRPPWDLPANATQSGMVSRTIGG
GLTNYNGVRFEDKPGLEQYWEQAERDMARLTKNDETQVIGANADLSVGANRSVLVGANSTSTVLGASAQS
VALASSIQVGLARSVVVGATHALNVALANATNVGGANLTNVGGYNALSVGGAHQVAAGGAATLVAGGAVA
IGAGGELVLSADTIKIVGKKKVIIQGGEIHLNSDDCCGGGGGGAGGGLAALSSLAGLKLLGGGIGLPLPL
PPLPIPPIIPPIPTIDPPVPTIDPPEPTVTPEPTVTPEPTVTPEPTDTPEPTVTPEPTDTPEPTVTPEPT
DTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPE
PTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTEPPETPEPTPTDEQ
TPPP
 
Nucleotide Sequence: 2745 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1563912-1561168 Yersinia enterocolitica subsp. palearctica Y11, complete genome
TTGAGCAGCCCGGCTATGCCCTATTTATTGGGTGAGCCTGCGCTGGTACTGTCGAAGTTAGAAGGAGAGG
AAGCCTTTTCGACTTTGTATTCATATACCATCACGGCAAAAACGCCGGCTAACCCCTCCATTCCTTGGCA
GACAGCCTCTAATGTCGATCTCAAAGCCTTAATTGGTAAAGAGATGACCATTGAAATGGAACTGGATGGT
AATGGTCTCGATTATGTAAAAGGTGTCGGTAAAGGCACGCGTGAAATTTCTGGTTTGGTCGAAAAAGCCC
GATTTATTGGCCGCGATGCCAATCAGGCAATGTTTGAAATTGTCCTTCGACCTTGGTTCTACCTCACAGA
TTTAACCTCTGACTTTAAGATTTTTCAAAATAAAAATGTAGTAGATATTATTGATGAAGTGCTTGCTGAC
TATAACTTTCCGTTTGAAAAGCGGCTGGCGACGACTTATCCAATACTCGACTTCCAGGTGCAATACGGTG
AAACCGACTTTAATTTCCTCCAGCGTTTAATGGAGGAGTGGGGTATTTACTGGTTCTTTGAACATGATGA
TCATAAACAAAAATTAATTCTGGTCGACCATGTCGGTGCTCACAAACGTTATTTCAGTGAAGCTTACCAT
ACCATTGAATATCTCTCGGATGAGCCAAAGGCCGGGGAAGAATACATCACCCAATTCCAGACTCAGGAAA
CGCTAACTACTGGGCGCTGGGTCTATAACGACTACGATTTCACCAAATCTCGTGCTGACATTTTGACGAT
GGACAGCAAGCCACGCAAAACCAGTTTTAGCGATCTTGAAATTTATCAATGGCCTGGGGATTATGATCAG
CCGGATATCGGGGAACATCTGGCGCGGGTGCGTATTGAGGAGCGCGGCGCATTGGGTTCGCGTGCCGTCG
GTTGTGGCGAAGTTCGTGGCATCGTTTGCGGTGCTAACTTCGAACTGCAAGGCTTCCCGGTTGATAAAGC
TAACCGCGAATACATGGTTATCTCCAGCCGTTTGTCGGTTTCTGAAGTGGCACAGCTATCCCGTGGGGAT
GAGTTTCACTATGAAACTACGTTTACAGTTCAGCCAACCACCAAGATCTATCGGCATCCACAACTTACAC
CGAAGCCAAAAACCAGCGGGCCACAGAATGCTATCGTTGTGGGCCCACCGGGCGAAGAGGTATGGACTGA
TGAATATGGCCGGGTAAAAGTACGTTTTGTCTGGGACCGTTACGGCAAAAACGCAGAGTCGGACTCATGC
TGGTTACGCGTGAGCCAGGCTTGGGCTGGGAACAGTTTTGGTGGCATTTACATTCCGCGTATTGGTCAGG
AAGTGTTGGTGGACTGCATCAATGGCGACCCGGATCGCCCGTTGGTCAGCGGTAGTCTTTACAATAACGT
GACTCGACCACCTTGGGATTTACCTGCGAATGCCACACAAAGTGGTATGGTCAGCCGTACTATTGGCGGA
GGGCTAACCAACTATAACGGCGTGCGTTTTGAGGACAAACCGGGCCTGGAGCAATACTGGGAGCAGGCCG
AGCGCGATATGGCGCGTCTGACGAAAAATGATGAAACACAAGTCATTGGCGCTAATGCTGATCTGAGTGT
GGGGGCCAACCGCAGCGTGCTTGTAGGGGCTAATTCGACATCAACTGTTCTTGGTGCTTCCGCGCAATCC
GTCGCTTTAGCGTCTTCAATACAAGTTGGATTGGCACGGAGTGTGGTCGTGGGAGCCACTCATGCGCTGA
ATGTCGCTTTAGCCAATGCCACCAACGTGGGGGGGGCCAACCTGACCAACGTCGGTGGTTACAACGCACT
TTCTGTCGGTGGTGCTCATCAGGTAGCCGCTGGCGGTGCTGCGACACTGGTTGCTGGTGGTGCTGTGGCG
ATCGGTGCGGGTGGTGAGCTGGTGCTCAGTGCTGATACCATCAAGATTGTCGGTAAAAAGAAAGTCATTA
TTCAAGGGGGAGAGATCCACCTTAACTCTGATGATTGTTGTGGCGGCGGAGGCGGCGGTGCGGGTGGTGG
CTTAGCCGCGCTTTCAAGCCTGGCGGGGCTGAAGCTACTGGGGGGAGGTATCGGGCTACCATTGCCATTA
CCACCATTGCCGATACCACCGATCATTCCACCGATACCGACAATTGATCCGCCGGTGCCAACAATTGATC
CGCCAGAGCCGACGGTAACGCCAGAGCCGACGGTAACGCCAGAGCCGACGGTAACGCCGGAGCCGACCGA
TACGCCGGAGCCGACGGTAACGCCAGAGCCGACCGATACGCCAGAGCCGACGGTAACGCCAGAGCCGACC
GATACGCCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAGCCGA
CCGATACGCCAGAGCCGACCGATACGCCGGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAGCC
GACCGATACGCCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAG
CCGACCGATACGCCAGAGCCGACCGACACGCCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAG
AGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCAGAACCGACCGATACGCC
GGAGCCGACCGATACGCCGGAGCCGACTGAACCACCAGAGACACCAGAGCCAACACCAACGGATGAACAG
ACGCCTCCGCCTTGA