SecReT6
Protein ID: 386309008
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15651
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1567921..1569297 [-]
Productouter membrane protein ImpK/VasF, OmpA/MotB domain
NoteTssL
UniProt IDE7B4M8
KEGG IDyey:Y11_15651
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.90E-55, Aligned region: 86..291
OmpA [PF00691], Evalue: 4.30E-17, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|386309008|ref|YP_006005064.1| outer membrane protein ImpK/VasF, OmpA/MotB domain [Yersinia enterocolitica subsp. palearctica Y11]
MSDSSELNPGIPMPSFDQSRDADTNPQALGHFLLDEPSVYTESTQSGAAFSHEATRSPGFQPYDTAQLRG
ESVQQRVAKAVASPTPLLEAAQPLLRALSEMPQEIADASQVQILKESLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGVMSGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADCLEVLLRILG
LGFEGRYSIIEEGDRQLTKIRQGLLTLLQSTRDTVPTALSPHGLIAHQFRKRRGIFVPVRVSMLLCGFLI
AATFIGSKYFLSVPESDLLKRMEALQRPVIVPTVAVQKLRLAILLKDEIAKQLVSVDETSSHSKVIFKGD
TMFQVGSDKVRPEIMSVIERVAQEVHRVQGAVLIIGHTDSMPINKPGFPNNQVLSEKRAANVARFMEKAG
IPTDKIQFEGKGDTQPVSSNDDAAGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1569297-1567921 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGAGTGATAGTAGTGAATTGAACCCTGGGATACCGATGCCCTCCTTTGATCAAAGCAGAGATGCGGATA
CCAATCCGCAGGCGTTAGGCCATTTCTTGCTTGATGAGCCGAGTGTTTACACCGAGAGCACACAATCTGG
TGCGGCGTTCAGCCACGAGGCTACGCGCTCACCGGGTTTTCAGCCCTATGATACCGCCCAGCTTCGAGGC
GAAAGTGTCCAGCAGCGCGTGGCTAAAGCGGTCGCGTCTCCAACGCCATTATTGGAGGCGGCACAGCCAT
TGTTACGTGCCTTAAGCGAGATGCCACAAGAGATAGCGGATGCTTCGCAGGTTCAGATATTAAAAGAGAG
CCTGAAGAATGAGATAACCCTGTTTAGTGTGGTATGTGATGAAGCGGATATCTCGTGGAAGAAAATGGCG
ATCGTCCGCTATTGCTTGTGTACCGCGCTAGATGAAGCGGCTCACACCATGTCGTGGGGCGTCATGTCGG
GTTGGTCGCAAAGCAACCTGCTAAACCATTTTGAAGGTGATAACGACGGCGGGAATAAATTTTTCCTGTT
AGTGGGCCGTCTGTCAATGAGCCCACATGAATATGCGGATTGCTTAGAGGTATTGCTGAGGATTTTAGGG
CTGGGTTTTGAAGGCCGTTACAGCATTATCGAAGAGGGTGACCGGCAATTAACCAAAATCCGTCAGGGAT
TGCTGACGTTACTGCAAAGTACCCGCGATACTGTTCCTACTGCGCTTTCTCCGCATGGATTAATCGCGCA
TCAGTTCCGCAAAAGGCGAGGGATCTTTGTTCCGGTTCGTGTGTCGATGCTGCTGTGTGGTTTCTTGATT
GCGGCCACCTTTATTGGCAGTAAATATTTTCTCTCCGTACCCGAAAGTGACTTGCTGAAGAGAATGGAAG
CCCTGCAACGTCCGGTTATCGTACCAACCGTTGCGGTACAAAAACTACGTCTGGCTATTTTGTTAAAAGA
CGAGATAGCGAAGCAGCTAGTGAGTGTTGATGAAACAAGCAGTCACAGCAAAGTCATCTTCAAAGGCGAC
ACCATGTTCCAGGTGGGTTCGGATAAAGTCCGGCCCGAAATCATGAGTGTCATCGAGCGTGTTGCGCAGG
AAGTTCATCGCGTACAGGGGGCGGTGCTGATTATTGGGCATACCGACTCTATGCCGATCAACAAACCAGG
TTTCCCTAATAACCAGGTGCTTTCTGAGAAACGTGCTGCCAACGTTGCACGCTTTATGGAAAAAGCGGGT
ATCCCGACTGACAAAATTCAGTTTGAAGGGAAAGGGGATACGCAGCCAGTCAGTAGTAATGACGATGCAG
CCGGGCGTTCACAAAACCGCCGTGTAGAAATCTTTGTTAATTATTGA