SecReT6
Protein ID: 386309009
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15661
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1569294..1570643 [-]
Productprotein ImpJ/VasE
NoteTssK
UniProt IDE7B4M7
KEGG IDyey:Y11_15661
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-143, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|386309009|ref|YP_006005065.1| protein ImpJ/VasE [Yersinia enterocolitica subsp. palearctica Y11]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPDHLGKLIYLAVPLRLDNSDETIFDEYDMSSLARFYAYEADLSDTNAIRQG
PKPVQLSRLRLKLVSESEMTESWIGLPLAKVRAIQPDGSVLLHLEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRADMLAKRLSNSDGKASASAEIVDYLLLQIFNKYEPSLDHLRNIPELPPIVLYQELAKFAGELSTFI
RTKTRRPRPAPGYDHGKLYPSIRPLVDDVHELLNQILVRAGQMIPLDPKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELMKSGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1570643-1569294 Yersinia enterocolitica subsp. palearctica Y11, complete genome
GTGAGAACTAATAAAGTCGTTTGGAGTGAGGGTCTTTTTCTTCGCCCGCAACTTTTTCAACAGCAAGAGC
GGTATCTTGAATATTACGCTCATAAACGAGCCGCCACGATTACCCCATTCTTTTGGGGATTCGCACAATA
TGAAATTGATCGCGAAGCGCTCTCCTATGGCAAGTTGGTACTGCGATCTGGCAAAGGAGTATTACCGGAC
GGTACGCCTTTTGATATTCCCGGTCATGCTGAACTGCCTGAGCCACTTACCATCACCCCAGATCATTTGG
GCAAACTAATCTATCTGGCGGTTCCGTTGCGGCTGGATAACAGTGATGAAACTATTTTTGACGAATATGA
CATGAGCTCATTGGCGCGTTTTTATGCCTATGAAGCAGACCTCAGTGACACTAATGCTATTCGCCAGGGG
CCGAAGCCGGTGCAGTTGTCGCGGCTGCGGCTTAAATTGGTTTCTGAAAGCGAAATGACCGAATCATGGA
TTGGGTTGCCACTGGCCAAAGTCAGGGCGATTCAGCCTGATGGTAGCGTACTGCTGCATCTGGAAGACTA
CATTCCTCCGGTGACGGGATATGCGGCGAGTTCACTGCTGTCAGAGTGGCTGACCCATCTTAATGGCTTG
GTCAAAATGCGTGCCGATATGCTGGCTAAACGTCTGTCAAACAGTGATGGCAAAGCTAGCGCCAGTGCTG
AAATTGTCGACTATTTGCTGCTGCAAATTTTTAATAAATACGAGCCAAGTCTGGATCATCTGCGCAATAT
TCCAGAATTACCGCCAATCGTGCTTTATCAAGAACTTGCCAAGTTTGCCGGTGAATTATCCACCTTCATT
CGGACCAAAACGCGTCGGCCGCGCCCGGCTCCGGGATATGACCACGGGAAACTCTACCCGTCGATTCGCC
CATTGGTGGACGATGTGCATGAATTGCTCAATCAGATTCTGGTGCGTGCAGGGCAGATGATCCCGTTGGA
CCCAAAAGGGAATGGCGTATGGTCTGCCTCTGTGCTGCCTAATGAATTACGTTCATTTTCCAATTTGGTA
TTGGCTGTTCATGCACAATTACCAATGGACGTATTGCAGCATCAATTCTCAGTACAGACCAAAATCAGTG
CGCCACAACAGTTGCATGAACTGGTGCGCTCACATTTACCGGGTCTCGAATTACAGCGGTTGCCGGTTCC
ACCGCGGCAAATTCCGTACAGTGCGGGATACGTTTATTTCGAATTGATGAAAAGCGGGCCGTTTTGGGAC
AAAGTTTCTAATGCAGGGGCCATTGCACTACACGTGGCTGGCGATTTCCCTGCGTTGAAAATGGAACTCT
GGGGGATTAGAGATTCATGA