SecReT6
Protein ID: 386309010
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15671
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1570647..1571183 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDE7B4M6
KEGG IDyey:Y11_15671
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.70E-35, Aligned region: 22..172
Cag12 [PF13117], Evalue: 0.0083, Aligned region: 20..49
Protein Sequence: 178 a.a.     [Download]
>gi|386309010|ref|YP_006005066.1| type VI secretion lipoprotein/VasD [Yersinia enterocolitica subsp. palearctica Y11]
MKKNIRWFNRITQYFFVALVTLLVMACSSKPKPEPVDKLSVELTTAKNINPNDKGVANPLRITVYTLKNT
DEFKSSDFFTITEEGTPSLKEQMEKVFDGIMLPNETKTIELTLNSGVTAIGVVAAYREIEQAEWNAVFSP
LPKKRVQPWYKKWWSGKQNEPVVKVRVERRSISIKEMD
 
Nucleotide Sequence: 537 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1571183-1570647 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGAAAAAAAATATCCGTTGGTTTAATCGGATTACACAATACTTTTTCGTGGCATTGGTCACGCTATTGG
TCATGGCATGTAGCTCGAAGCCTAAACCCGAACCGGTTGATAAATTGAGCGTCGAGCTGACTACGGCAAA
AAATATCAATCCAAATGACAAAGGTGTCGCTAATCCGTTAAGGATCACAGTTTATACCCTGAAGAATACG
GATGAATTTAAGTCGAGTGATTTCTTCACTATTACCGAAGAGGGTACTCCATCTCTGAAAGAGCAGATGG
AGAAAGTGTTTGACGGAATCATGCTACCTAATGAGACAAAAACAATAGAACTGACGCTAAACAGTGGCGT
CACTGCCATCGGCGTCGTTGCTGCTTACCGTGAAATTGAGCAGGCGGAGTGGAACGCGGTTTTTAGCCCG
TTACCCAAGAAACGCGTGCAGCCCTGGTATAAAAAATGGTGGTCAGGGAAACAAAACGAACCGGTAGTCA
AGGTGCGCGTTGAGCGTCGGTCAATATCAATCAAAGAAATGGACTAA