SecReT6
Protein ID: 386309012
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15691
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1572222..1573718 [-]
Productprotein ImpC
NoteTssC
UniProt IDE7B4M4
KEGG IDyey:Y11_15691
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-193, Aligned region: 66..492
Protein Sequence: 498 a.a.     [Download]
>gi|386309012|ref|YP_006005068.1| protein ImpC [Yersinia enterocolitica subsp. palearctica Y11]
MSTLEAKNKPAAAATEYSDFNSLLTKEFKAKSEQTKAAVEGAVKTLAEQALANSVTVSDDAYKSIASIIA
EIDSKLSEQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQSP
LFKKVYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQELSN
PRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLARLPYGIRTNPVDAFHFEETTDGADHGKYVWSN
AAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFI
PLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEM
QRWLNDWVMNYVDGDPANSSIETKARRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVAK
LPSLKDVA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1573718-1572222 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGTCCACTTTAGAAGCAAAAAATAAACCAGCCGCTGCTGCGACTGAATATAGCGACTTTAATTCGTTAT
TGACCAAAGAATTCAAGGCTAAGTCTGAGCAGACCAAAGCGGCAGTAGAAGGTGCCGTTAAAACATTGGC
TGAGCAGGCGCTGGCTAACTCGGTAACTGTATCTGATGATGCTTATAAAAGCATTGCCTCTATTATTGCT
GAGATCGACAGTAAATTGTCTGAGCAGATCAATTTGATCTTGCATCATCAAGAGTTTCAGTCTCTGGAAA
GTGCCTGGCGTGGCCTGCACTATTTAGTGAATAACACCGAGACTGATGAGAAATTGAGATTACGTTTTCT
CGACATCTCTAAAGATGAATTACGCCGTAATATGAAGCGTTATAAAGGTGTGGCGTGGGATCAGAGCCCA
TTATTCAAAAAAGTCTATGAAGAAGAGTACGGCCAATTGGGCGGCGAACCTTATGGTTGCCTGGTGGCGG
ATTACTACTTTGACCATACTGCGCCTGACGTTGATTTGCTGGCTTCCATCGGTAAGGTTGCTGCTTCTGC
ACACGTACCTTTTATCACTGGTGCCGCGCCGTCAGTATTGCAGATGGAATCCTGGCAAGAGCTGTCAAAT
CCGCGTGATTTGACCAAGATCTTTACTCAGAATCTTGAGTATGCTGCCTGGAACTCACTGCGTCAGTCCG
AAGACTCCCGTTATATTGGCCTGGCAATGCCGCGTTTCCTGGCGCGTCTGCCATACGGTATTCGCACTAA
CCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGACGGTGCCGACCACGGCAAATATGTGTGGTCCAAC
GCGGCGTATGCTATGGCTGTTAACATCAACCGTTCATTCAAAGAATACGGCTGGTGTACCCTGATTCGTG
GTGTGGAAAGTGGTGGTGTGGTGGAAGGCTTGCCATGTCATACATTCCCAACTGATGATGGTGGCATTGA
TATGAAGTGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAATTGGCTAAAAATGGCTTTATT
CCACTGGTGCACAGAAAAAATACTGATTATGCGGCATTTATTGGCGCGCAATCATTGCAAAAACCTGCTG
AATATTACGATTCAGATGCTACAGCTAACGCTAACTTGTCGGCGCGTTTGCCGTACCTGTTCGCCTGTTC
ACGTTTTGCCCATTACCTGAAATGTATCGTGCGTGACAAAATCGGCTCATTCAAAGAGCGCGATGAGATG
CAACGCTGGTTGAACGATTGGGTCATGAACTATGTAGATGGTGATCCGGCAAACTCTTCTATCGAGACTA
AAGCACGCCGTCCGTTGGCCGCAGCTGAAGTTATTGTTGAAGATGTTGAAGGTAACCCAGGTTATTACCA
GGCTAAATTCTTCCTGCGCCCACACTTCCAATTGGAAGGTTTGACGGTATCACTGCGCATGGTTGCTAAA
TTACCTTCACTGAAAGATGTTGCGTAA