SecReT6
Protein ID: 386309013
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15701
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1573742..1574194 [-]
Productprotein ImpB
NoteTssB
UniProt IDE7B4M3
KEGG IDyey:Y11_15701
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-50, Aligned region: 2..140
Protein Sequence: 150 a.a.     [Download]
>gi|386309013|ref|YP_006005069.1| protein ImpB [Yersinia enterocolitica subsp. palearctica Y11]
MEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNFDERMKAMKPRVAFAVKNTLTGEGQ
LMVDITFESLNDFSPDEIAKKVDSLSQLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLATLASAPK
TKQSAADAPQ
 
Nucleotide Sequence: 453 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1574194-1573742 Yersinia enterocolitica subsp. palearctica Y11, complete genome
GTGGAAATATATGGAAGTGAGAAAAAGGTTGAATTGCCATTCGTCATGGGCGTGCTGGCTGATTTATCCG
GTAAGCCTCTTGAACCTTTACCTTCAGTAGCAGATAGAAAGCTGCTGGATATCGACATCGATAATTTCGA
TGAGCGTATGAAAGCAATGAAACCACGAGTTGCATTTGCTGTGAAAAATACGCTGACGGGTGAAGGCCAG
TTGATGGTGGATATTACTTTTGAGAGCCTGAATGACTTTTCTCCCGATGAAATTGCTAAGAAAGTCGATT
CTCTGTCTCAATTGTTAGATGCCCGTACTCAATTGGCAAACTTGCAAACCTATATGGATGGCAAGGCAGG
TGCAGAGGAATTAGTAATGAAACTTCTGAAAGACAAATCATTACTGGCAACACTGGCATCCGCACCGAAA
ACAAAGCAATCCGCTGCTGATGCTCCACAGTAA