SecReT6
Protein ID: 386309019
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15761
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1579369..1582038 [-]
Productclpb protein
NoteTssH
UniProt IDE7B4L7
KEGG IDyey:Y11_15761
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-39, Aligned region: 230..310
AAA_2 [PF07724], Evalue: 3.50E-39, Aligned region: 618..784
AAA [PF00004], Evalue: 3.80E-21, Aligned region: 232..363
AAA [PF00004], Evalue: 3.80E-21, Aligned region: 623..709
ClpB_D2-small [PF10431], Evalue: 2.00E-16, Aligned region: 790..862
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 622..738
Sigma54_activat [PF00158], Evalue: 9.70E-08, Aligned region: 228..248
Sigma54_activat [PF00158], Evalue: 9.70E-08, Aligned region: 622..722
AAA_22 [PF13401], Evalue: 9.80E-07, Aligned region: 232..312
AAA_22 [PF13401], Evalue: 9.80E-07, Aligned region: 366..398
AAA_22 [PF13401], Evalue: 9.80E-07, Aligned region: 509..547
AAA_22 [PF13401], Evalue: 9.80E-07, Aligned region: 620..642
AAA_22 [PF13401], Evalue: 9.80E-07, Aligned region: 684..709
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 209..248
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 270..310
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 426..494
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 497..548
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 620..658
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 687..710
AAA_16 [PF13191], Evalue: 4.10E-06, Aligned region: 786..821
AAA_25 [PF13481], Evalue: 4.60E-06, Aligned region: 232..305
AAA_25 [PF13481], Evalue: 4.60E-06, Aligned region: 620..648
AAA_19 [PF13245], Evalue: 9.30E-06, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 9.30E-06, Aligned region: 620..644
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 232..322
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 621..704
Zeta_toxin [PF06414], Evalue: 7.10E-05, Aligned region: 232..248
Zeta_toxin [PF06414], Evalue: 7.10E-05, Aligned region: 610..662
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 223..255
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 620..647
IstB_IS21 [PF01695], Evalue: 7.30E-05, Aligned region: 226..254
IstB_IS21 [PF01695], Evalue: 7.30E-05, Aligned region: 622..641
IstB_IS21 [PF01695], Evalue: 7.30E-05, Aligned region: 732..752
IstB_IS21 [PF01695], Evalue: 7.30E-05, Aligned region: 800..848
NACHT [PF05729], Evalue: 0.00016, Aligned region: 232..265
NACHT [PF05729], Evalue: 0.00016, Aligned region: 509..541
NACHT [PF05729], Evalue: 0.00016, Aligned region: 622..649
AAA_17 [PF13207], Evalue: 0.00029, Aligned region: 232..249
AAA_17 [PF13207], Evalue: 0.00029, Aligned region: 376..405
AAA_17 [PF13207], Evalue: 0.00029, Aligned region: 622..657
Arch_ATPase [PF01637], Evalue: 0.00092, Aligned region: 211..245
Arch_ATPase [PF01637], Evalue: 0.00092, Aligned region: 286..382
Arch_ATPase [PF01637], Evalue: 0.00092, Aligned region: 486..534
Arch_ATPase [PF01637], Evalue: 0.00092, Aligned region: 621..667
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 232..252
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 465..538
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 620..647
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 232..249
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 624..651
TIP49 [PF06068], Evalue: 0.0058, Aligned region: 232..252
TIP49 [PF06068], Evalue: 0.0058, Aligned region: 281..312
TIP49 [PF06068], Evalue: 0.0058, Aligned region: 622..657
SRP54 [PF00448], Evalue: 0.0096, Aligned region: 231..256
SRP54 [PF00448], Evalue: 0.0096, Aligned region: 621..643
Protein Sequence: 889 a.a.     [Download]
>gi|386309019|ref|YP_006005075.1| clpb protein [Yersinia enterocolitica subsp. palearctica Y11]
MAITRKNLFGKLDATLFKGIESATTICKLRGNPYVELIHWVNQLWHQEDNDLKHIVRYFAVDVDAFERGL
AQALARLPVGATSISDFSYHIELAIERAWVYASLECLDTRIRSGHLLLAMLTNMELRRALLAIAPEMEKI
PLEHLSSDFNFITQASPETNEAATDGSPMYDGALPGEASNAINGKSTATLAQYTTDLTALAREGKIDPVL
GRNHEISTMVDILLRRRQNNPLLTGEAGVGKTAVVEGLALAIVAGEMPPALSQVSLLTLDVVALSAGASM
KGEFEARLKNVLDEAMASPTPVILFIDEVHTLVGAGGNAGTGDAANLLKPALARGQLRTIGATTWSEFKR
HIEKDPALTRRFQVLQVDEPDEDTAISMLRGLTPALEKHHGVWIMDEALQAAVRLSHRYIPARQLPDKAI
SLLDTACARVAVAQFSQPAELQQLTFQSETAQTELSSLEKARHFGKGQDERAALLEATIAQHSEAANKLE
QRWQAERDLVTAITATRTALYELVSQPTPDEEKRQQYQQQLAQLEEQLLLIRSAQPLVQAEVNATVIANI
VADWTGIQVGQMLKDDIRAVMELPQRLEERVIGQPHALVQLSENIMTARAGMADPRKPLGVFMLVGPSGV
GKTETALAIAESMYGGEQNLITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEI
EKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLFADPDTAPDQDGILSALQPEL
LKVFPAAFLGRVTVIPYLPLQQSALQHIVRLHLDRIGQRLQSQHQLTLQYSDVVVDDVVSRCSVAETGAR
MLIRYIEQNITPEIGKFILRDHDAIPNQIVFVDKVENKFTISVLNEKDK
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1582038-1579369 Yersinia enterocolitica subsp. palearctica Y11, complete genome
GTGGCTATTACAAGGAAAAATCTTTTCGGCAAACTGGATGCCACTCTTTTCAAAGGTATTGAAAGTGCGA
CAACGATTTGTAAATTGCGTGGCAACCCTTATGTAGAGTTGATTCATTGGGTGAACCAACTTTGGCATCA
AGAAGATAACGATCTTAAACATATTGTTCGCTATTTTGCTGTCGACGTAGATGCTTTTGAACGTGGCCTG
GCTCAAGCACTTGCCCGTTTGCCCGTCGGTGCGACCAGCATTTCAGATTTTTCATACCATATCGAATTAG
CAATCGAACGGGCATGGGTGTACGCCAGCCTGGAGTGTTTAGATACACGTATTCGCAGCGGACATTTGTT
GCTGGCAATGCTAACCAATATGGAGTTGCGCCGGGCACTGTTGGCTATTGCTCCAGAAATGGAAAAAATT
CCACTGGAGCATTTGAGCAGCGATTTTAACTTTATTACGCAGGCATCGCCGGAAACCAATGAAGCGGCCA
CCGATGGTAGCCCAATGTATGACGGCGCATTACCGGGTGAAGCCAGCAATGCTATTAACGGCAAAAGTAC
CGCGACATTGGCGCAGTACACCACGGATCTGACTGCATTAGCTCGTGAAGGCAAGATAGACCCGGTACTG
GGGCGCAACCATGAAATCAGTACGATGGTGGATATTTTACTGCGTCGTCGACAAAACAACCCGTTGCTCA
CCGGTGAAGCTGGCGTGGGTAAAACAGCCGTAGTTGAGGGTCTGGCGCTGGCCATTGTCGCGGGTGAAAT
GCCTCCAGCACTGAGTCAGGTGAGTCTGCTAACCCTGGATGTTGTGGCTCTTTCGGCGGGTGCCAGCATG
AAAGGCGAGTTTGAAGCACGCCTGAAGAATGTTTTAGACGAAGCAATGGCTTCACCAACTCCTGTCATCC
TGTTTATAGATGAAGTTCACACTCTGGTCGGTGCGGGGGGGAATGCAGGAACCGGTGATGCAGCTAATTT
ACTCAAACCGGCACTGGCGCGCGGTCAGTTGCGCACCATTGGCGCGACAACCTGGAGTGAGTTTAAACGC
CATATTGAAAAGGATCCGGCGCTAACTCGTCGTTTCCAGGTACTTCAGGTCGATGAACCTGATGAAGATA
CTGCTATTTCGATGCTGCGTGGATTGACTCCGGCGTTAGAGAAGCACCACGGCGTATGGATCATGGATGA
AGCCTTGCAAGCTGCGGTGCGATTATCGCATCGTTATATCCCTGCTCGCCAGTTACCGGATAAAGCGATC
AGCTTGCTTGACACCGCTTGTGCACGTGTTGCCGTCGCACAATTCTCACAGCCGGCAGAATTGCAGCAAT
TGACTTTCCAGAGTGAAACCGCGCAAACCGAGTTGTCATCGCTGGAAAAAGCCCGACATTTCGGCAAAGG
GCAGGACGAGCGCGCAGCACTGTTAGAAGCCACGATTGCTCAGCACTCGGAAGCGGCAAACAAACTTGAA
CAACGTTGGCAGGCAGAGCGTGACTTGGTCACCGCTATTACAGCTACGCGAACGGCGCTGTATGAACTGG
TGTCGCAACCCACGCCTGATGAAGAAAAACGCCAGCAGTATCAGCAGCAATTGGCGCAACTTGAAGAGCA
ATTATTGCTTATTCGCAGTGCGCAGCCTTTGGTACAAGCTGAGGTTAATGCAACCGTGATCGCCAACATT
GTTGCGGATTGGACCGGGATTCAAGTCGGACAAATGCTCAAAGACGATATTCGTGCCGTGATGGAGCTGC
CGCAACGCCTCGAAGAGCGAGTGATTGGTCAGCCGCATGCGTTAGTCCAGTTGAGCGAAAATATTATGAC
TGCACGTGCGGGGATGGCAGACCCAAGGAAACCGTTGGGTGTCTTTATGTTGGTTGGCCCTTCCGGGGTG
GGTAAAACAGAAACGGCATTGGCCATTGCGGAAAGTATGTATGGTGGTGAGCAAAACCTTATCACGATTA
ATATGAGCGAATACCAAGAGTCACATACGGTTTCCTCATTAAAAGGCTCGCCACCGGGCTACGTGGGATA
TGGCGAAGGTGGTGTATTAACCGAGGCAGTACGGCGTAAACCTTATAGTGTTGTGCTATTAGATGAAATT
GAAAAAGCACATTCAGATGTCCATGAACTGTTCTTCCAGGTATTTGATAAAGGCCAGATGGAAGATGGCG
AAGGGCGGTTTATTGATTTTAAGAACACTATTTTGCTGTTAACCAGCAATGTGGGTAGCGAATTATTAAG
TAACTTATTTGCTGATCCGGATACTGCTCCCGATCAAGATGGAATATTAAGTGCGTTGCAACCTGAATTG
CTGAAAGTATTCCCCGCCGCATTTTTGGGTCGCGTCACTGTGATTCCTTATTTGCCGCTCCAGCAGAGCG
CGTTGCAGCATATTGTTCGATTACATTTAGATCGTATCGGCCAGCGTTTACAGTCTCAGCATCAGCTGAC
GTTGCAATACAGTGATGTGGTCGTTGACGATGTAGTTAGCCGCTGCTCAGTAGCAGAAACCGGCGCCCGT
ATGCTTATTCGTTATATTGAACAGAATATTACACCTGAAATTGGCAAATTTATTTTACGTGACCACGATG
CGATACCTAATCAGATCGTGTTCGTCGATAAAGTTGAAAATAAATTTACTATTTCTGTACTGAATGAAAA
AGATAAATAA