SecReT6
Protein ID: 386309020
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15771
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1582755..1584635 [+]
Productprotein ImpG/VasA
NoteTssF
UniProt IDE7B4L6
KEGG IDyey:Y11_15771
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.80E-204, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|386309020|ref|YP_006005076.1| protein ImpG/VasA [Yersinia enterocolitica subsp. palearctica Y11]
MDHKFLDYYNKELTFMREMAQEFADKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYNVPRGSSFFTHISPGETTRCEFRSGQDVGLWP
LEITEARLSSIPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLQFSQLAGLDRLPIYINGDERIVSHIFEL
LHASHVATIIRAGHGVTAEDTVISNDALAFEGLSPDQSLLPLSWNIFHGHNLMQEYFTCRQRFYFFTLTQ
LSKSLSNNHTNEAEIIILLDRLPQELVSHVAPSRFLLNCTPVINLFQKRMDKIEINRALNDFHVVPDRSR
PLDYEVFSITKVFGQQAETSKEVVFNPLYQTRHCDNGNFGRYFSITRKPRTSQNNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDNLRYLSIEAQVTNRDLPRLITSNGNFELTMSDSAPVHGAHFVFQPSPPRAPFAIDE
SAWRLIRQLSFNYLPLSDMTHANGGESLRNMLRLFVSASDLESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGLIMENYLARHAAINVFTETELHSMQRGRVGQWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|386307442|ref|NC_017564.1|:1582755-1584635 Yersinia enterocolitica subsp. palearctica Y11, complete genome
GTGGATCACAAATTTCTTGATTACTATAATAAAGAACTGACTTTTATGCGTGAAATGGCGCAGGAATTCG
CAGATAAGCATCCTAAAATAGCGGGCCGCTTAGGCATGCATGGGATTGAAGTTGCCGACCCCTATGTCGA
ACGCCTGATCGAGTCTTTCTGCTTTCTCTCTGCCAGAACACAAATTAAGCTGGATGCCGAATTCCCTAAA
TTTACTCAGCGCTTGCTGGATATTGTCTATCCCAATTACAACTCTCCCACCCCTTCAATGGGAGTGATTC
AACTTAAGCCAAACCTAAAAGAGGGTGATCTGACTCAGGGCTATAATGTCCCTCGTGGCAGTTCGTTTTT
CACCCATATTTCCCCAGGTGAAACGACCCGTTGTGAATTTCGCAGTGGGCAGGATGTTGGATTATGGCCG
CTGGAGATAACAGAAGCGCGCCTAAGCTCCATTCCTCCCGATATGCCTAATCTGGAAAAGCACCGTATTG
CCTATCATCGACTAAAGGGTGCCTTGCGCATTAAGCTAAAACTGGTCGGCGACCTGCAATTTTCGCAACT
AGCAGGGTTAGATCGCCTGCCTATCTATATCAATGGTGACGAGAGGATAGTCTCTCACATCTTTGAACTT
CTGCATGCCAGCCATGTTGCAACTATCATCCGTGCAGGGCACGGCGTGACAGCTGAAGATACCGTGATAA
GCAATGACGCTCTTGCTTTTGAGGGGTTAAGCCCTGATCAAAGCCTGTTGCCACTGTCGTGGAATATTTT
TCATGGCCATAACCTGATGCAGGAATACTTCACCTGCCGCCAGCGATTCTATTTTTTCACACTGACTCAG
TTGTCCAAAAGTCTAAGCAATAATCACACCAACGAAGCGGAGATTATTATCTTACTGGACCGGTTGCCAC
AGGAGCTGGTGAGTCATGTTGCCCCCTCTCGCTTCCTATTGAACTGCACCCCGGTGATTAATCTATTCCA
GAAGCGCATGGACAAGATTGAGATTAATCGTGCACTGAATGACTTTCACGTGGTGCCAGACCGAAGCCGA
CCGCTCGATTACGAAGTTTTCTCCATCACGAAAGTCTTTGGTCAACAAGCGGAAACCAGTAAAGAGGTGG
TATTTAACCCCCTCTACCAAACCCGCCATTGCGACAATGGCAATTTTGGTCGTTATTTTTCCATTACCCG
TAAGCCCAGAACGAGTCAGAATAATAAGCGTAAATATGACACCCGTACGCCTTATGCCAGTACGGAGGTC
TTCGTTTCGCTGGTTGATCAACAAGAAGCGCCCTACGGAGATAACCTGCGGTATTTATCCATTGAGGCGC
AGGTGACTAACCGAGATCTGCCGCGGTTGATTACCAGTAATGGCAATTTTGAATTAACCATGTCGGATTC
AGCTCCAGTACACGGCGCGCACTTTGTATTTCAGCCCAGCCCCCCTCGGGCCCCTTTTGCGATAGATGAA
TCTGCCTGGCGGTTAATCCGTCAGCTCAGTTTTAACTACTTGCCACTATCCGATATGACTCATGCTAATG
GGGGGGAGTCGCTACGTAACATGCTGCGTCTGTTTGTTAGCGCCTCAGATCTTGAGTCGAATACCCAAAT
CGATGCACTGGTTGGCTGCAAAAGTGAGCCGGTAATCAGACGACTACCCGGTAATGGCTTACTGGTTTAT
GGTCGTGGGATCTGTTGCACCCTGACCGTTGATGAAGAAGGGTTCTCAGGTATCAGCCCCTATCTGTTTG
GCTTGATCATGGAAAACTATTTGGCACGCCACGCCGCGATCAATGTGTTTACCGAGACTGAACTGCACTC
GATGCAAAGAGGACGTGTCGGTCAGTGGAAAGCCCGTCCTGGTCGCCGGGGAGTGCTGTAA