SecReT6
Protein ID: 386309021
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15781
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1584635..1585660 [+]
Productprotein ImpH/VasB
NoteTssG
UniProt IDE7B4L5
KEGG IDyey:Y11_15781
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.40E-90, Aligned region: 21..321
Protein Sequence: 341 a.a.     [Download]
>gi|386309021|ref|YP_006005077.1| protein ImpH/VasB [Yersinia enterocolitica subsp. palearctica Y11]
MQPDDNIQQQNQLNLDTWYQQAEPWNAGFISMMRANAARTPDMPAPAKAMLPKQETFRIGQSANMAFSPR
EIAHVEMKDGKMDLQLFGLGIWGPHGAMPLQMTELAYTRAELHDHTLTDFADLFHHRALSQLYRAWFVSQ
DTASLDRQHDEKFSFYIGSLVGLDPAELTHSALPVHAHLASSAHLIREARNPEGLVGALQYYFEVPVSMV
EYAQQWIFLDKSDQTQLGDGASAMLLGDGAILGDTVLDRQHKFELILGPLSLQQYLRFSPSGQDLPVLRE
WVRNFVGFEYAWEVQLLLTAAEVPTATLEGTSQLGYTSWLAREDVSANVRGMSFEPEMHLY
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|386307442|ref|NC_017564.1|:1584635-1585660 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGCAACCCGATGACAACATACAGCAACAGAACCAACTCAATCTGGATACCTGGTATCAGCAAGCAGAGC
CATGGAATGCCGGTTTTATCAGCATGATGCGGGCTAATGCGGCCCGAACTCCCGATATGCCCGCTCCCGC
TAAAGCTATGCTGCCGAAACAGGAAACCTTTCGTATCGGGCAAAGTGCCAATATGGCGTTCTCACCACGT
GAGATAGCCCATGTTGAAATGAAAGACGGGAAGATGGACCTACAGCTTTTTGGTCTGGGTATCTGGGGGC
CGCACGGCGCGATGCCGTTGCAAATGACTGAACTGGCCTACACCCGCGCTGAGTTGCATGACCATACACT
GACCGACTTTGCCGATCTATTTCATCATCGGGCGCTATCACAGCTCTATCGCGCATGGTTTGTCTCTCAG
GACACCGCTTCGCTTGACAGGCAACATGATGAGAAATTCTCTTTTTATATCGGCAGCCTGGTCGGTTTAG
ACCCAGCGGAGCTGACACATAGTGCGCTGCCGGTGCATGCTCATCTGGCTTCATCCGCCCATCTTATTCG
TGAAGCACGTAACCCCGAAGGCTTAGTCGGCGCATTGCAATACTACTTTGAAGTGCCGGTCAGCATGGTC
GAATACGCCCAACAGTGGATCTTTCTGGATAAAAGTGACCAGACGCAATTGGGCGATGGTGCCTCGGCGA
TGCTGTTAGGTGACGGTGCCATTCTGGGCGACACCGTTTTAGACCGACAGCATAAGTTTGAGCTGATACT
TGGCCCGCTCAGCCTGCAACAGTATTTGCGTTTCAGCCCATCAGGACAGGATTTACCGGTATTACGTGAA
TGGGTTCGTAACTTTGTCGGATTTGAATATGCCTGGGAAGTGCAGTTGTTGTTAACCGCCGCTGAGGTTC
CTACCGCCACATTGGAGGGCACCAGCCAGTTGGGGTACACCAGTTGGTTAGCCCGAGAGGATGTCTCAGC
CAACGTACGCGGAATGAGTTTTGAACCCGAAATGCACCTTTATTAA