SecReT6
Protein ID: 386309022
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15791
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1585738..1586886 [+]
Productprotein ImpA
NoteTssA
UniProt IDE7B4L4
KEGG IDyey:Y11_15791
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-16, Aligned region: 62..121
Protein Sequence: 382 a.a.     [Download]
>gi|386309022|ref|YP_006005078.1| protein ImpA [Yersinia enterocolitica subsp. palearctica Y11]
MSVHSIADSRGYYHRLMQPIPGDHPCGLSLEYDSAFLMLQTKLQPKLTAEYGNFVEVAEPTNWTDTERKC
LELLGKARDIRLLIILMRCRMRQIGVSAVQEGLEALLWCLSTWPDDLHPQLLDEGEFEPFMRANAFAELD
DIDGFIADFRNQPLPKAAGMQISVKELEKAHSFPREEGALEEATLEAIEHDWQARSDNAILSLQKAYALL
LELTTRLSHSLGDVTPDFVRLTAVLRLFGGSNMADIAPIAAFETPEYITATEATEVYTTAPEWQPEEIVT
AVSVPTDTATPTYPPAPHMSPLQSPPPIAVAAQVPIAPKGIQNRADALSRLIEVRQWFATTEPSSPVIAL
LSFSEKTIGKSFGELLQIIPPELISKLDAGQE
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|386307442|ref|NC_017564.1|:1585738-1586886 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGAGTGTACATAGTATCGCTGATAGCAGAGGTTATTATCACCGCCTGATGCAACCTATTCCAGGTGACC
ATCCTTGCGGCCTAAGTCTGGAATATGACTCAGCATTTCTGATGCTGCAAACAAAACTGCAACCCAAGTT
GACCGCCGAGTACGGCAACTTTGTTGAAGTCGCTGAGCCTACCAACTGGACCGATACCGAGCGAAAATGC
CTGGAGCTGCTAGGTAAAGCCCGTGACATTCGGTTACTGATTATTCTGATGCGCTGTCGAATGCGTCAAA
TTGGCGTAAGTGCGGTGCAGGAAGGGCTGGAAGCACTACTGTGGTGCCTGAGTACCTGGCCGGATGATCT
ACATCCACAGTTACTTGATGAAGGCGAATTTGAACCTTTTATGCGGGCCAATGCTTTTGCAGAATTAGAC
GATATCGATGGTTTTATTGCTGATTTTCGCAACCAACCCCTGCCCAAAGCCGCAGGAATGCAAATATCAG
TCAAAGAGCTTGAGAAAGCGCATTCGTTCCCGCGCGAAGAAGGTGCATTGGAAGAAGCCACTTTGGAAGC
CATTGAACATGATTGGCAGGCCCGTTCCGATAACGCGATCCTCTCATTGCAAAAAGCTTATGCATTGTTG
TTGGAATTAACCACACGTCTTAGCCATTCTCTCGGTGATGTCACCCCTGACTTCGTCAGATTGACTGCGG
TGTTACGCCTCTTTGGTGGGAGCAATATGGCCGATATCGCGCCTATCGCAGCCTTTGAAACACCTGAATA
TATTACGGCAACCGAGGCCACTGAAGTCTATACAACGGCCCCGGAGTGGCAGCCTGAGGAAATAGTCACC
GCGGTCAGTGTACCCACTGATACTGCGACTCCCACTTATCCCCCCGCGCCACACATGTCACCATTGCAAT
CGCCACCGCCGATAGCTGTTGCGGCGCAAGTTCCAATCGCGCCAAAAGGCATTCAAAATCGCGCGGACGC
GTTATCCCGACTCATTGAAGTCCGCCAATGGTTTGCGACTACCGAGCCTAGCAGCCCGGTGATTGCGCTA
TTGTCATTTTCAGAAAAAACCATTGGCAAAAGCTTTGGTGAATTACTGCAAATCATTCCGCCAGAACTGA
TTTCTAAACTTGATGCAGGACAGGAGTAG